Cronobacter turicensis: CTU_02850 Help Entry CTU_02850         CDS       T00999                                  Name (GenBank) hypothetical protein   KO K02358   elongation factor Tu Organism ctu  Cronobacter turicensis Brite KEGG Orthology (KO) [BR:ctu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03012 Translation factors [BR:ctu03012]     CTU_02850    03029 Mitochondrial biogenesis [BR:ctu03029]     CTU_02850   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ctu04147]     CTU_02850 Translation factors [BR:ctu03012]  Eukaryotic type   Elongation factors    CTU_02850  Prokaryotic type    CTU_02850 Mitochondrial biogenesis [BR:ctu03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial transcription and translation factors    Mitochondrial translation factors     CTU_02850 Exosome [BR:ctu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    CTU_02850   Exosomal proteins of breast cancer cells    CTU_02850   Exosomal proteins of colorectal cancer cells    CTU_02850 SSDB OrthologParalogGFIT Motif Pfam:  GTP_EFTU DO-GTPase2 Motif Other DBs NCBI-ProteinID:  CBA27154 UniProt:  C9XTC0 LinkDB All DBs Position 321560..321712 Genome browser AA seq 50 aa AA seqDB search MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDPR NT seq 153 nt NT seq  +upstreamnt  +downstreamnt atgtctaaagaaaagtttgaacgtacaaaaccgcacgttaacgtcggtactatcggccac gttgaccatggtaaaacaacgctgaccgctgccatcactaccgttctggcgaaaacctac ggtggttctgctcgtgcattcgatccacgttga

DBGET integrated database retrieval system