Cuculus canorus (common cuckoo): 104068924 Help Entry 104068924         CDS       T08597                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism cuca  Cuculus canorus (common cuckoo) Pathway cuca04010   MAPK signaling pathway cuca04012   ErbB signaling pathway cuca04068   FoxO signaling pathway cuca04137   Mitophagy - animal cuca04140   Autophagy - animal cuca04144   Endocytosis cuca04150   mTOR signaling pathway cuca04210   Apoptosis cuca04218   Cellular senescence cuca04370   VEGF signaling pathway cuca04371   Apelin signaling pathway cuca04510   Focal adhesion cuca04540   Gap junction cuca04625   C-type lectin receptor signaling pathway cuca04810   Regulation of actin cytoskeleton cuca04910   Insulin signaling pathway cuca04912   GnRH signaling pathway cuca04916   Melanogenesis cuca05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cuca00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104068924 (HRAS)    04012 ErbB signaling pathway     104068924 (HRAS)    04370 VEGF signaling pathway     104068924 (HRAS)    04371 Apelin signaling pathway     104068924 (HRAS)    04068 FoxO signaling pathway     104068924 (HRAS)    04150 mTOR signaling pathway     104068924 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     104068924 (HRAS)    04140 Autophagy - animal     104068924 (HRAS)    04137 Mitophagy - animal     104068924 (HRAS)   09143 Cell growth and death    04210 Apoptosis     104068924 (HRAS)    04218 Cellular senescence     104068924 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     104068924 (HRAS)    04540 Gap junction     104068924 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104068924 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104068924 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     104068924 (HRAS)    04912 GnRH signaling pathway     104068924 (HRAS)    04916 Melanogenesis     104068924 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104068924 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cuca04131]     104068924 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cuca04147]     104068924 (HRAS)    04031 GTP-binding proteins [BR:cuca04031]     104068924 (HRAS) Membrane trafficking [BR:cuca04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     104068924 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     104068924 (HRAS) Exosome [BR:cuca04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    104068924 (HRAS)   Exosomal proteins of colorectal cancer cells    104068924 (HRAS) GTP-binding proteins [BR:cuca04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     104068924 (HRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin DUF6974 Ldh_1_N Motif Other DBs NCBI-GeneID:  104068924 NCBI-ProteinID:  XP_053924233 LinkDB All DBs Position 5:44644232..44686645 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVIS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgaatataagctggtggtggtgggagctggtggtgttgggaagagtgctttgacg atacagctcattcagaatcattttgttgatgaatatgatcctacaattgaggattcttac agaaagcaagttgtcatcgatggagagacctgcttgttagatattttggatactgcaggg caagaggagtacagtgccatgagagaccagtacatgagaacgggagaaggattcctttgt gtcttcgccatcaacaacaccaagtcctttgaagacattcaccaatatagggaacagatc aagagggtgaaagactcagatgatgttcccatggtgctggtgggaaataaatgtgaccta ccagcccggacagtagagacgaggcaagcgcaggacctggcccggagttacgggatcccc tacatagaaacttctgccaaaaccagacagggcgttgaagatgccttctataccttggtg cgagagattcgtcagcacaagctgcgcaagctgaatcccccagatgagagcggccctggc tgtatgaattgtaaatgtgtgatatcatga

DBGET integrated database retrieval system