Cheilinus undulatus (humphead wrasse): 121517718 Help Entry 121517718         CDS       T07473                                  Symbol tnnc1a Name (RefSeq) troponin C type 1a (slow)   KO K05865   troponin C, slow skeletal and cardiac muscles Organism cud  Cheilinus undulatus (humphead wrasse) Pathway cud04020   Calcium signaling pathway cud04260   Cardiac muscle contraction cud04261   Adrenergic signaling in cardiomyocytes cud04814   Motor proteins cud04820   Cytoskeleton in muscle cells Brite KEGG Orthology (KO) [BR:cud00001]  09130 Environmental Information Processing   09132 Signal transduction    04020 Calcium signaling pathway     121517718 (tnnc1a)  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     121517718 (tnnc1a)    04820 Cytoskeleton in muscle cells     121517718 (tnnc1a)  09150 Organismal Systems   09153 Circulatory system    04260 Cardiac muscle contraction     121517718 (tnnc1a)    04261 Adrenergic signaling in cardiomyocytes     121517718 (tnnc1a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:cud04812]     121517718 (tnnc1a) Cytoskeleton proteins [BR:cud04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Troponins      121517718 (tnnc1a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 AIF-1 EF-hand_4 SPARC_Ca_bdg DUF1707 DUF5580_M RNA_pol_Rpb4 Dak2 DUF5390 Motif Other DBs NCBI-GeneID:  121517718 NCBI-ProteinID:  XP_041655639 LinkDB All DBs Position 11:29779644..29792260 Genome browser AA seq 161 aa AA seqDB search MNDIYKAAVEQLTDEQKNEFKAAFDIFVQDAEDGCISTKELGKVMRMLGQNPTPEELQEM IDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELAELFRMFDKNADGYIDLEELKTM LESTGEAITEDDIEELMKDGDKNNDGKIDYDEFLEFMKGVE NT seq 486 nt NT seq  +upstreamnt  +downstreamnt atgaacgacatctacaaggcagcggttgagcagctgactgatgaacagaaaaatgagttc aaggctgcctttgacatctttgtccaagatgccgaggacggttgcatcagcaccaaggag ctggggaaggtgatgaggatgctgggccagaaccccacacccgaagagctgcaggagatg attgatgaggtggatgaagacgggagtggaacagttgattttgatgaatttctggtcatg atggtgaggtgcatgaaggacgacagcaaagggaaatcagaggaggaactggcggagctg tttcgcatgtttgacaaaaacgcagacggttacattgacctggaggagctgaagacaatg ctggagtccacaggagaggcgataactgaggatgacatcgaggagctgatgaaggatgga gacaagaacaatgacggcaaaattgactatgatgagttcttggagttcatgaaaggagtg gaataa

DBGET integrated database retrieval system