Corynebacterium variabile: CVAR_0487 Help Entry CVAR_0487         CDS       T01594                                  Name (GenBank) Dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism cva  Corynebacterium variabile Pathway cva00790   Folate biosynthesis cva01100   Metabolic pathways cva01240   Biosynthesis of cofactors Module cva_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:cva00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     CVAR_0487 Enzymes [BR:cva01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      CVAR_0487  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      CVAR_0487  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      CVAR_0487 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AEK35836 UniProt:  G0HBY1 LinkDB All DBs Position 568740..569036 Genome browser AA seq 98 aa AA seqDB search MVWTDFSAATASDEISETISYVDLADIAVAVVEGPSLDLIETLAATIADRLNDLAGVIAV EVTVHKPDAPIHHPFTDVRVVARRSQKSSQRPVAGTGQ NT seq 297 nt NT seq  +upstreamnt  +downstreamnt gtggtctggaccgacttctccgcagccacggcgtccgacgagatcagtgagaccatctcg tacgtcgatctcgccgacatcgccgtggcggtcgtcgagggaccctcgctcgacctcatc gagacgctcgcggcgaccatcgccgaccggctcaacgacctggccggggtgatcgccgtg gaggtcaccgtgcacaaacctgatgccccgatccaccaccccttcaccgacgtgcgcgtc gtcgcccgacggtcccagaagtcgtcccagaggcctgtggcggggacgggacagtga

DBGET integrated database retrieval system