Charadrius vociferus (killdeer): 104294805 Help Entry 104294805         CDS       T08577                                  Symbol CCL17 Name (RefSeq) C-C motif chemokine 17   KO K21083   C-C motif chemokine 17 Organism cvf  Charadrius vociferus (killdeer) Pathway cvf04060   Cytokine-cytokine receptor interaction cvf04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:cvf00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     104294805 (CCL17)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104294805 (CCL17)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cvf04052]     104294805 (CCL17) Cytokines and neuropeptides [BR:cvf04052]  Cytokines   Chemokines    104294805 (CCL17) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 DUF7096 Motif Other DBs NCBI-GeneID:  104294805 NCBI-ProteinID:  XP_009892761 LinkDB All DBs Position Unknown AA seq 87 aa AA seqDB search MLAARTVLLLTMLLTFSLHCAAAHFTPTECCFKYAQKPIRYMQSFYETSSDCSLPAVVIV AASGDEVCTDPKKPWVKRAMKKLQRKK NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgctcgctgcaaggaccgtcctgctgctcacgatgctcctcaccttctccctgcactgc gctgcagcccacttcactcccaccgaatgctgcttcaagtacgcgcagaaacccatccga tacatgcagagtttctatgagacgtccagcgactgctccttgccggccgttgtgattgtg gctgccagcggtgacgaggtctgcaccgaccccaagaagccctgggtgaagagagccatg aaaaagcttcaaaggaaaaaatga

DBGET integrated database retrieval system