KEGG   Chlorella variabilis: CHLNCDRAFT_51513
Entry
CHLNCDRAFT_51513  CDS       T02924                                 
Name
(RefSeq) hypothetical protein
  KO
K15877  fungal nitric oxide reductase [EC:1.7.1.14]
Organism
cvr  Chlorella variabilis
Pathway
cvr00910  Nitrogen metabolism
cvr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cvr00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    CHLNCDRAFT_51513
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:cvr00199]
    CHLNCDRAFT_51513
Enzymes [BR:cvr01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.14  nitric oxide reductase [NAD(P)+, nitrous oxide-forming]
     CHLNCDRAFT_51513
Cytochrome P450 [BR:cvr00199]
 Cytochrome P450, fungi type
  CYP55 family
   CHLNCDRAFT_51513
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 17355964
NCBI-ProteinID: XP_005848845
JGI: ChlNC64A_1_51513
UniProt: E1ZC32
LinkDB
Position
Unknown
AA seq 417 aa
MQRSVLSPLRRAVAGSAGGGKGAPLSAAASRPFASASEPQPQGEDVGSFPFARPKGYEPP
AEFARLRRECPVARARLFEGSPIWLITKPRELQQVLVDNRFSKVRTHPGFPELAPGAKAA
VEGREASYVDMDPPEHTRYRAIFEPFFDAEAAQVEELIDGMQRRGPGADGGVDLAEAFSL
PLAFRVIYEMLGIPFEDYEFLSSNVAVRASGSSTARDAAAAQQQLQEYMEGLVAAKEAKP
TDDVLSKVIRSHLVAGNATVASMINLGLLSLLEHPDQLEALKGDPSLLPCAVREICRYHT
ASAYALRRMALEDVKVGDVTVKAGEGLIALNQSANRGEEAFPDPDAFDIRHSPNPQVGYG
YGTHLCVAMPLAMAELECAFGGLLRRLPTIKLAVAPDQLQWSDPKADVGLTGLPVTW
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgcagcgttcggtgctctcccccttgcgccgcgctgtggcaggcagtgccggcggcggc
aaaggcgccccgctctccgccgcagcgtcgcgcccctttgcctcggcatcggagccccag
ccccagggcgaggacgtgggcagcttcccctttgccaggcccaagggctacgagccgcct
gccgagtttgcgcggctgcgccgggagtgccccgtggctagggcccgcctgtttgagggc
agccccatctggctcatcaccaagccgagggagctgcagcaggtgctggtggacaaccgc
ttcagtaaggtccgcacccaccctggcttcccggagctggctccgggtgccaaggctgcg
gtggaggggcgggaggcgagctatgtcgacatggacccgccagagcacacccgctaccgc
gccatcttcgagccctttttcgacgccgaggcagcccaggtggaggagctgattgacggc
atgcagcggcgggggcccggcgccgacggcggcgtggaccttgcggaggcgttctcgctg
ccgctggccttcagggtgatctacgagatgctgggcatccccttcgaggactacgagttc
ctgtccagcaacgtggcggtgcgcgccagcggcagctccaccgcgcgcgacgccgccgcg
gcgcagcagcagctgcaggagtacatggaggggctggtggccgccaaggaggcgaagcct
actgacgatgtgctgagcaaggtcatccggagccacctggtggcgggcaatgccaccgtc
gcctccatgatcaatctgggcctgctcagcctgctggaacaccccgaccagctggaggca
ctcaagggcgacccctcgctgctaccatgcgcggtgcgagagatctgccgctaccacact
gcctcagcctacgctctgaggcgtatggcgctggaggatgtcaaggtgggcgacgtgacg
gtgaaagcgggtgagggcctcatcgcgctgaaccagagcgccaaccggggcgaggaggcc
ttcccagacccagacgcctttgacatcaggcactccccgaacccgcaggtgggctacggg
tatggcacccacctgtgcgtggccatgcctctggcgatggcggagctggagtgcgccttt
ggcggcctgctgcgccgcctgcccaccatcaagctggcggtcgcgcccgaccagctgcag
tggtcagacccgaaggcagacgtgggcctgaccggcctgcccgtcacctggtga

DBGET integrated database retrieval system