KEGG   Dactylosporangium aurantiacum: Daura_37940
Entry
Daura_37940       CDS       T08497                                 
Name
(GenBank) PPOX class F420-dependent oxidoreductase
  KO
K21301  5a,11a-dehydrotetracycline reductase [EC:1.3.98.4]
Organism
daur  Dactylosporangium aurantiacum
Pathway
daur00253  Tetracycline biosynthesis
daur01057  Biosynthesis of type II polyketide products
daur01100  Metabolic pathways
daur01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:daur00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    Daura_37940
   00253 Tetracycline biosynthesis
    Daura_37940
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:daur01008]
    Daura_37940
Enzymes [BR:daur01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.4  5a,11a-dehydrotetracycline reductase
     Daura_37940
Polyketide biosynthesis proteins [BR:daur01008]
 Polyketide tailoring proteins
  Others
   Daura_37940
SSDB
Motif
Pfam: Putative_PNPOx
Other DBs
NCBI-ProteinID: UWZ52397
LinkDB
Position
8570619..8571023
AA seq 134 aa
MSFTAKEVQYLRSQQLGRLATVGADGTPHNVPVGYRYNADLGTIDITGRDLRRSRKYRDV
QAGSRVAFIVDDLPSTAPIVARGLEVRGTAEALTGDEDLIRVRPVRIVTWGIEADWQAGP
TGRTVRPATPRSAT
NT seq 405 nt   +upstreamnt  +downstreamnt
gtgtccttcacggccaaggaagtgcagtacctgcggtcccagcagctggggcggctggcg
accgtcggcgccgacggcaccccgcacaacgtcccggtcggctaccggtacaacgccgac
ctcggcacgatcgacatcaccggccgggacctgcgccgcagccgcaagtaccgcgacgtg
caggccggcagccgggtcgccttcatcgtcgacgacctgccgtccacggcgccgatcgtc
gcccgcggcctcgaggtccgcggcaccgcggaggcgctcaccggcgacgaggacctgatc
cgggtccgccccgtgcggatcgtcacctggggcatcgaggcggactggcaggccggcccg
accggccgcaccgtgcggccggcgacaccgaggagcgcgacatga

DBGET integrated database retrieval system