KEGG   Drosophila arizonae: 108618976
Entry
108618976         CDS       T05886                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
daz  Drosophila arizonae
Pathway
daz00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:daz00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    108618976
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:daz00199]
    108618976
Enzymes [BR:daz01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     108618976
Cytochrome P450 [BR:daz00199]
 Cytochrome P450, animal type
  CYP306 family
   108618976
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 108618976
NCBI-ProteinID: XP_017870716
LinkDB
Position
X
AA seq 511 aa
MSADELGLAVFGVLLSLVCIAVALICQRRNARLLGRTPPGPWGVPLLGYLPFVDRLAPHK
SLQALARRYGAIYQLSMGSVRTVVLADAALVRDFLRHEELTARAPLYLTHGIMGGYGIIG
AGGDIWKYQRRQLIEWLKALGMTRKQCETRAQLEQRISNGVSECVQAYESEAKAPLDPLP
ALQHTLGNIINDLVFGETYERHDPNWLYLQQLQEQGVKLIGISGMVNFLPWLRHLPGNKR
SIRFLLDGKAKTHALYDRIIARCAQQLQQEKEQQQQQQSPGRSILAHFLHERQPYSQLYC
DEQLRHLLADLFGAGVDTSLATLRWFLLYMAREQRCQQRLQSELRNLSESPTLAELEPIA
YLRACLSEVQRIRSVVPLGIPHGVDQDTMVGDYHLRKGTMVLVLQWAIHMNPEAWPEPEQ
FRPERFLSADGDYVAPAQFIPFQTGKRMCPGDELARMMLTLYAGRILRRFHVQLPAGEAQ
HVDFEGECGITLAPAHYKLQFTPMEELPKND
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgagtgcagatgaactgggcctggccgtcttcggggtgctgctgtcgctcgtctgcatt
gcagttgcgctgatctgccagcggcggaatgcgcgtctgctgggccgcacgccgcccggg
ccgtggggcgtgccgctgctggggtacttgccgttcgtggatcggctggcgccgcacaag
tcgctgcaggcgctggcccggcgctacggcgccatctatcagctgagcatgggcagcgtg
cggacggtggtgctggcggatgcggcgctggtgcgcgactttctgcggcacgaggagctg
accgcccgggcgccgctctacctgacgcacggcatcatgggcggctatggcatcattggc
gccggcggcgacatatggaaatatcagcgcaggcagctgatcgagtggctcaaggcgctg
ggcatgacgcgcaaacagtgcgagacgcgtgcgcagctggagcagcgcatcagcaacggc
gtcagcgagtgcgtccaggcctacgagtcggaggcgaaggccccactggatccgctgccg
gcgctgcagcacacgctgggcaacatcatcaatgatctggtctttggcgagacctacgag
cgccacgatcccaactggctgtacctgcagcagctgcaggagcagggcgtcaagctgatc
ggcatctcgggcatggtcaactttttgccctggctgcgccatctgccgggcaacaagcgc
agcatacgcttcctgttggacggcaaggccaagacgcatgcgctctacgatcgcatcatc
gcacgctgcgcgcagcagctacaacaggaaaaggaacagcagcagcagcagcagtcgcct
ggccgcagcatcttggcgcacttcctgcacgaacgtcagccctactcgcaactgtattgc
gatgagcaactgcgtcacctgctggccgatctctttggcgccggcgtggacacgtcgctg
gcaacgctgcgctggttcctgctctatatggcgcgcgagcagcgctgccagcagcgactg
cagtcggagctgcgcaacctcagcgagtcgcctacgctggctgagctcgagccgatcgcc
tatctgcgcgcctgcctctcggaggtgcagcgcattcggtccgtcgtgccgctgggcata
ccgcacggcgtcgaccaggacaccatggtgggtgactaccacctgaggaagggcaccatg
gtgctggtgctgcagtgggccatacacatgaatcccgaggcctggccggagccggagcag
ttccggccggagcggtttctcagcgcggacggcgactatgtggcgcccgctcagttcatt
cccttccagacgggcaagcgcatgtgtcccggcgatgagctggcccgcatgatgctcacg
ctctacgcgggccgcattctgcgtcgcttccacgtccagctgcccgccggagaggcgcag
cacgtggacttcgaaggcgaatgtggcatcaccttggctccggcgcactacaaacttcaa
tttacccctatggaagagctacccaaaaatgattaa

DBGET integrated database retrieval system