KEGG   Diaphorina citri (Asian citrus psyllid): 103513300
Entry
103513300         CDS       T07332                                 
Name
(RefSeq) cytochrome P450 18a1-like
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
dci  Diaphorina citri (Asian citrus psyllid)
Pathway
dci00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:dci00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    103513300
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:dci00199]
    103513300
Enzymes [BR:dci01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     103513300
Cytochrome P450 [BR:dci00199]
 Cytochrome P450, animal type
  CYP306 family
   103513300
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 103513300
NCBI-ProteinID: XP_017301257
UniProt: A0A1S4EGR9
LinkDB
Position
Unknown
AA seq 719 aa
MDWPTPSMDIPTLIALLAIGLLWFLHRYRTFYSKLPPGPWGLPLLGYLPFLKPRNTYLQL
HEMGKRYGPIYSVQLGQLFAVVLCDAGLVKEAFSREEFNYRADLYVTHGIMDGCVGPKRD
LMERRIFVGVENLLSMIEATSGTAVDPHHIFLHTVGNVINDFLFGRTWEENDEKWAWLLS
LAEEGIKHVGVAGPVNFLPFLRLTSSRPARGACAKLPLHSCDAQEENSEFIDWKKIEMES
EYEKQAPHSTRLHTLLTNSFQGYLEEVGSITEMITRGACAKLPLLSCDAQEENSEFIDWK
KIEMESEYEKQAPHRCTLYSQTVSKDISKKLGQSPVLMAKLLGVKTTSAPSPPRRRHSQT
LLLRPTGTYITAPNPCRHTAECWTCYGEKQKAFERVETYVTAPELETVLSPFPGKRMCMG
GELARMIATLFLSNLIKQYRVTYESEEEILAARQGEFGLTLQPEASTYGKATTPPLLPPK
VRGLRVHSIKVNPNGLPRLRSWIRPLPMAKRQPRPPPLLPPKVRGLRVHSIKVNPNGLPR
LRSWVKNSVLTDFQDTLRAEITSKSSGTRVTLDDITSMSYLAACINETHRYRTIVTLGIP
HSNRVPTNIGGYLIPANTMVIPFLYSIHMNGEAHQEPHRFDPGRFLQDKLPAQFMPFQVG
KRMCMGGELARMIATLFLSNLIKQYRVTYESEEEILAARQGEFGLTLQPGPHKLRFTRI
NT seq 2160 nt   +upstreamnt  +downstreamnt
atggattggccgaccccctccatggacatccccaccctcatagctctactggccatcggc
ctcctgtggttcctccaccggtatcgcacattctactccaagctcccgccggggccgtgg
gggcttccccttctcggctacctcccattcttgaagcccaggaacacctacctccagctg
cacgagatggggaagaggtacggcccaatttatagcgtccagttggggcaactgtttgcc
gtggtgctatgcgatgccggtttggtgaaggaggcattctcgagggaagaatttaactat
cgggcagacctgtatgtgacgcatggcattatggacggttgtgtcgggccgaaacgagat
ctcatggaacggcgcatctttgtgggagtggaaaatttactgagcatgatcgaggctaca
tcaggcacggctgtggatccccatcacatctttctacacacggtcggcaacgttatcaat
gacttcctgtttggccgaacctgggaggagaatgatgagaaatgggcgtggctcttgagt
ctggcggaggaggggattaaacatgtgggcgtggccgggcctgtcaactttctccccttc
ttgaggttaacatcatcacgcccggcgcgcggcgcgtgcgcaaagcttccgctacactcg
tgcgacgcgcaagaggaaaactcagagttcattgattggaagaagatcgagatggaatct
gaatatgaaaaacaagctccacactccacacgactgcacactttactcacaaacagtttc
caaggatatctcgaagaagttgggtcaatcaccgaaatgatcacgcgcggcgcctgcgca
aagcttccgctactctcgtgcgacgcgcaagaggaaaactcagagttcattgattggaag
aagatcgagatggaatctgaatatgaaaaacaagctccacaccgctgcacactttactca
caaacagtttccaaggatatctcgaagaagttgggtcaatcaccggtactgatggctaaa
ctcctgggagtcaaaacaacctctgccccctccccacctaggcgcagacattctcagacg
cttcttctacgtccaactgggacatacataaccgcaccgaatccatgccgacatacagcc
gagtgttggacgtgctatggcgagaaacaaaaggcatttgaacgtgtcgagacatacgtc
accgcacctgaactggagacggtgctgtctccgtttccaggtaaaagaatgtgtatgggc
ggagagctggcccgcatgatagccaccctatttctctccaacctcatcaaacaatacaga
gtgacgtacgagagtgaagaggagatattggcggcccgccagggggagtttgggcttacc
ttgcagcccgaggcctctacctatggcaaggcgacaaccccgcccctcctgccccctaag
gtgcgaggtctacgggtacattccatcaaggtcaatccgaacggccttcccagactgcgg
agctggataaggcctctgcctatggcaaagcgacaaccccgccccccgcccctcctgccc
cctaaggtgcgaggtctacgggtacattccatcaaggtcaatccgaacggccttcccaga
ctgcggagctgggtcaaaaattccgtccttaccgatttccaggacactcttcgtgctgag
atcacctccaagtcttccggaaccagggtcaccctagatgacatcacctctatgagttac
ctagctgcctgtatcaatgaaacccatcgctatcgtaccattgtcaccctgggtatacct
cattctaaccgagtccctactaacataggtggctatttaataccagccaacacaatggtg
atcccgttcctgtattctattcacatgaatggggaggctcatcaggaaccacatcgcttt
gatcccggcagattcctacaggacaaactgcctgcccagtttatgccattccaagttgga
aaaagaatgtgcatgggcggagagctggcccgcatgatagccaccctatttctctccaac
ctcatcaagcaatacagagtgacgtacgagagtgaagaggaaatattggcggcccgccag
ggggagtttgggcttaccttgcagcccggcccacataaacttaggttcacccggatttag

DBGET integrated database retrieval system