Diaphorina citri (Asian citrus psyllid): 103521960 Help Entry 103521960         CDS       T07332                                  Name (RefSeq) histone H2A.Z   KO K11251   histone H2A Organism dci  Diaphorina citri (Asian citrus psyllid) Pathway dci03082   ATP-dependent chromatin remodeling Brite KEGG Orthology (KO) [BR:dci00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     103521960  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dci03036]     103521960   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dci04147]     103521960 Chromosome and associated proteins [BR:dci03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103521960 Exosome [BR:dci04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103521960 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone Motif Other DBs NCBI-GeneID:  103521960 NCBI-ProteinID:  XP_008485285 UniProt:  A0A1S3DP36 LinkDB All DBs Position Unknown AA seq 77 aa AA seqDB search AVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVI PHIHKSLIGKKGTQKPV NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gctgtgtacagtgctgctattctggaatacctgactgctgaagtgttggagttggcagga aatgcttccaaagatctgaaagtaaagagaatcaccccccgccatttacaacttgccatc agaggagacgaagagttggacagtctgatcaaggcaaccattgctggaggaggtgtcatc ccacatatccacaaatccctcattggtaaaaagggaacgcaaaaacctgtctaa

DBGET integrated database retrieval system