KEGG   Dechloromonas denitrificans: KI615_14850
Entry
KI615_14850       CDS       T08301                                 
Name
(GenBank) acylneuraminate cytidylyltransferase family protein
  KO
K24307  5-N-acetyl-7-N-(D-alanyl)-legionaminic acid cytidylyltransferase
Organism
dden  Dechloromonas denitrificans
Pathway
dden00541  O-Antigen nucleotide sugar biosynthesis
dden01100  Metabolic pathways
dden01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:dden00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    KI615_14850
SSDB
Motif
Pfam: CTP_transf_3 NTP_transf_3 IspD PQQ_2
Other DBs
NCBI-ProteinID: UCV06677
LinkDB
Position
complement(3123022..3123720)
AA seq 232 aa
MRILALIPARGGSKRLPGKNIRALGGRPLIAWSIEAARGVPGIADILVSTDDEEIAAASR
EHGAMVPWLRPAELATDDAGSAAVCVHALDWYEAQFGKVDGLLLLQPTSPFRGQETVLQG
LALYQVSGFRRVVSFSPAASHPMWCVRVEEGKIIPFVAGGGFGVRSQDLPAAYTVNGALY
LISPATLRNTYDFVGDDVVPLLMEGPELSIDIDTEFDWLYAEAVLASGAIAV
NT seq 699 nt   +upstreamnt  +downstreamnt
atgaggattctcgccctcattccagcacgtggaggttcgaagcgcctacctggaaagaac
atccgcgcacttggcggacgccccctgattgcctggagcattgaggcagcaagaggtgtg
ccggggattgccgacattctggtgtctaccgacgatgaggaaattgccgcagcctcgcgt
gagcacggcgccatggtcccatggctgaggccggctgaattggcaaccgatgatgcaggc
tccgcagcagtgtgtgtacatgcgctggactggtacgaggctcaattcggaaaggtcgac
ggccttcttttgctgcagcctacctctccctttcgcggtcaggaaacggtcttacaaggg
ctggcgctttatcaggttagtggctttcggcgcgtggtgtccttttctcccgcagcttct
catccaatgtggtgcgtcagggttgaggaaggaaaaatcattccatttgtagcaggcggc
ggcttcggtgtgcgctctcaggatttgcccgctgcctatacagttaacggcgcgctttat
ctgatcagcccggctacgctgagaaatacgtatgacttcgttggagacgatgtggtgccg
ttgctgatggaaggcccggagctaagtatcgacatcgataccgagttcgactggctgtac
gcagaggctgttctggcttccggcgccattgcggtctag

DBGET integrated database retrieval system