KEGG   Desulfitobacterium dehalogenans: Desde_3696
Entry
Desde_3696        CDS       T02146                                 
Name
(GenBank) tetrahydromethanopterin S-methyltransferase, subunit H
  KO
K25221  [methyl-Co(III) glycine betaine-specific corrinoid protein]---tetrahydrofolate methyltransferase [EC:2.1.1.378]
Organism
ddh  Desulfitobacterium dehalogenans
Pathway
ddh00670  One carbon pool by folate
ddh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Desde_3696
Enzymes [BR:ddh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.378  [methyl-Co(III) glycine betaine-specific corrinoid protein]---tetrahydrofolate methyltransferase
     Desde_3696
SSDB
Motif
Pfam: MtrH CobD_Cbib CbiG_C
Other DBs
NCBI-ProteinID: AFM01969
UniProt: I4ADD4
LinkDB
Position
complement(3713977..3714897)
AA seq 306 aa
MFKFTAQQHVYDINGVKVGGQPGEYPTVLIGSIFYRGHKIVSDGQKGVFDKEAAKALLDQ
EAELSAETGNPFIIDVLGESVEALTKYVEFILKNTTAPFLLDSISPEVRVGTLKNLGKDP
EIQKRLIYNSIEEHYTEEELAAIKDAGIKTAVILAFSKKALKPNARIDLLQGKDDKEGLI
AAAKRAGVEQFLVDPGVLDVASSSWTTEAINVVKEQFGYPGGCAPSNAVYLWKKMRSKGT
PFFEVAGAAVFTYPITQGADFILYGPMMNAPWVYRAIATTDAMIAYNNKLTGVKMGTTEH
PLLKIF
NT seq 921 nt   +upstreamnt  +downstreamnt
atgttcaaatttactgctcaacaacatgtttatgacatcaacggggttaaagttggtggt
cagccgggggaatacccaacagtactcattggtagtattttttatcggggtcataagatc
gtctcagatggtcaaaagggggttttcgacaaagaggcagccaaagctttgctggatcag
gaagccgaactaagtgcagaaacaggtaatccatttatcattgatgtattgggagaatct
gttgaagcacttacgaaatacgtagaatttattttaaaaaatactactgctcccttcctc
ttagatagtattagcccagaggttcgggtaggaaccttgaaaaacctgggcaaggatccc
gagattcagaaaaggttgatctataactccatcgaagaacattataccgaagaagaactt
gccgccatcaaagatgcgggaatcaagacagccgtcatcctggcttttagcaagaaggct
ttaaaacccaacgccagaatcgatcttctccagggcaaggacgataaagagggactgatt
gcggcggctaaacgggccggcgtagagcaattcctggtcgatccgggagtgttggatgtg
gccagttcaagctggacgacggaagcgatcaatgtggtcaaagagcagttcggctatccc
ggtggctgcgcaccatccaatgcagtctatctctggaagaagatgcgttccaaaggaaca
cccttctttgaagtggctggggctgcggtcttcacttacccgatcacacagggtgcggat
ttcattctctatggtcctatgatgaacgcgccttgggtttatcgtgctatagcaaccaca
gatgccatgattgcctataacaacaagctgaccggggttaagatgggaacgacagagcat
cctttgctcaaaattttctaa

DBGET integrated database retrieval system