KEGG   Debaryomyces hansenii: DEHA2G18942g
Entry
DEHA2G18942g      CDS       T01026                                 
Name
(RefSeq) DEHA2G18942p
  KO
K12575  kinetochore protein SLK19
Organism
dha  Debaryomyces hansenii
Pathway
dha04111  Cell cycle - yeast
dha04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:dha00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    DEHA2G18942g
   04113 Meiosis - yeast
    DEHA2G18942g
SSDB
Motif
Pfam: Fungal_TACC Fib_alpha ERM_helical
Other DBs
NCBI-GeneID: 8999249
NCBI-ProteinID: XP_002770666
UniProt: Q6BHF8
LinkDB
Position
G:complement(1540711..1543428)
AA seq 905 aa
MTSPLRFEADMSMIEGEKLSPIKIPPSRLSTNTTSPDILAKHPHGLSAKQDARRNTVHNE
TPKGLTATPLTKKAEPLYSVNKRIPLTSPRATNQPNLDSLKKSKTKLDARLYELKSSSRH
GSPSNKENMHNSGKSTQASQLSSDVNSSISHKSPFESSPSKIDTPIKQINSSFAKNVKSS
PPKSSPSKADKRSIEDDSVIENSRKIAKVITNANESEVSHHKSDDEHSIQIDQVFNKEDL
VGRFSSGASPAKLHEPTVIDEDSDGDIYNNEVNTSHTMTSKMRGNESTQLSRIIKITDEV
DYVTPQRYTEPVAKSPEINQQHRIKENVINNTESKETISPLKNHMLSVNSDQKENHVSSN
RMEDENSDGFNELEDEPTINFLLSPNSKPVFSLDHIKKVQDDHFKEVANLEEVINNKNQE
ILKFSEELSATNNKFLIYDQKIKELKQDKKKLIANENLLLIQLKHNERELASMTKALRIK
ENTVTQLESRLSKSKSKYESTANELESVIEEGNTLREQIKRLEKSVEDKSISQKEYESQI
KILNDEIKEKDTEISSLTDANIDYNIKVENLLSEKEELLTETGRLGRENNGLEEINSKQQ
ELLEELDKLENLAKDKIMTLENTLDSKTQEIKQVMTEKNELLTKIDNLTEENKNSGRELQ
QYKDDVEELTNKLNNYNNARSDLDDKINRLQEGLNKSNEANESLQNKVSGLLEEIERLNQ
HVSESETQMDLLKSINTEKDEIISGDTKKMGELVQKVNKQKQVIADYEKDYSKALEDIKS
LQSKGENTSLNDEIEDLKKQVSQGQAKTNARIQEVAEQLYFEYSKKHELKVNQVRASFKK
QIDNLHFEKKSQARDIDSLQKKLEIVNMEKNQLLRLIDEYQSGSDHNPKKKLSPKKSGIK
KPSRY
NT seq 2718 nt   +upstreamnt  +downstreamnt
atgacctctccgcttagatttgaagctgatatgtccatgattgaaggtgagaagctatca
ccaataaagattcctccatctagactttctacgaacacaacgagccctgatatcttagca
aaacatcctcatggattaagtgctaagcaggatgccagaagaaatacagtacataatgaa
accccaaagggcttaacggctactccattaacgaagaaagcagaaccattgtattcggtg
aataagagaattccattaacatcacctcgagctactaatcaaccgaacttggattcgttg
aaaaaatccaaaacgaaattagacgccagattatatgaattaaagtcgtccagccgccac
ggtagtccatctaataaggaaaacatgcataattcgggtaaaagtacacaggccagccaa
ttgtctagtgatgtgaactcatctatatcgcataaaagtccatttgagtcgtcaccttcg
aagatagatactcccatcaaacagatcaattcttcgtttgcgaaaaatgtgaagagttct
cctcccaaaagtagtccttctaaagcggacaaacgtagcattgaagatgattctgttatt
gaaaattctcgcaagattgccaaagtaatcactaatgctaatgaatcagaagtttcacat
cataaatctgatgacgagcatctgatccaaattgaccaggtatttaataaagaagatttg
gttggtcgcttcagttctggagcttcacctgctaaattacacgagcccacagtcatagac
gaagatagtgacggcgatatctataataatgaagttaacacatcgcacacaatgacgtct
aaaatgcgtggcaatgaaagtactcagctcagtaggatcataaagattactgatgaggta
gattatgttacaccccaaagatataccgaaccagtcgccaaaagtcccgaaataaatcaa
cagcatcgcatcaaagaaaacgtcatcaataatacagaatcaaaggagaccatcagtccg
ttaaagaatcatatgttatcggtcaatagtgaccaaaaagagaatcacgtttcatctaat
agaatggaagacgaaaattctgatggatttaatgaattagaagacgaaccaacaatcaat
tttttgttatcgccaaattcaaaacctgttttctcgctagaccatataaaaaaggttcaa
gatgatcattttaaggaggttgcgaacttggaggaagtgatcaataataaaaatcaagag
attttaaaattctctgaagaattatcagccacaaataataaattcttaatatatgatcaa
aaaattaaggaattgaagcaagataagaaaaaattgatcgcaaatgagaatctattatta
atacagctcaaacataatgaaagggaattagcttcgatgactaaggctttaaggatcaaa
gaaaatactgtaacccaattagaatcaagattatccaagagtaaaagtaaatatgaatct
actgcaaatgaattggagtctgttattgaagaaggtaataccttaagagagcaaattaaa
agactagaaaagagcgttgaagacaaaagcatttcacagaaagaatacgaatcacaaata
aagatccttaatgatgaaatcaaagaaaaagacaccgaaatctcgtcattgaccgatgct
aatatcgattacaacattaaggttgaaaatttattaagcgaaaaggaagaattattaact
gagactggacgtttgggaagggaaaacaacggattagaggaaataaattcaaaacaacaa
gaattgctagaagaattagacaagcttgagaatcttgctaaggataagatcatgactctc
gaaaatacgcttgattccaaaacacaagaaatcaagcaagtaatgactgagaaaaatgag
ttattgactaaaattgataacttaactgaagaaaataagaacctgggacgcgaattgcaa
caatataaggatgacgttgaggaactaacgaataaattgaataattataataatgctaga
agtgatttggatgacaagattaatcgtttacaggaaggattaaataagtctaatgaagca
aatgaatcattgcagaataaagtaagtggattgcttgaagaaatcgaaaggcttaatcag
catgtaagtgagtcagaaactcaaatggatttgctaaaatctattaatactgaaaaagac
gaaataataagtggtgatactaaaaaaatgggtgaattggttcaaaaagtaaataaacag
aaacaagttatcgcagattatgaaaaagattattcaaaggcattagaagatatcaaatct
ctccagtctaagggcgaaaatacttcattgaatgacgaaattgaagatttaaagaagcaa
gtttcccaaggccaagccaagacgaacgcaagaattcaagaagttgctgaacagctatac
ttcgaatattcaaagaaacatgaattgaaggttaatcaggtaagagccagtttcaagaag
caaattgataacttgcactttgagaagaaatcacaagctagagatattgatagtttacaa
aagaagttagagattgttaacatggaaaaaaatcaattgttacgtttgatcgatgaatat
caatccggctctgaccataatcctaagaagaagctaagtcccaaaaaatctggcattaag
aaacctctgagatattag

DBGET integrated database retrieval system