Dialister sp. UW_FK_DIAL1_1: ACFWUL_03860 Help Entry ACFWUL_03860      CDS       T11244                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism diu  Dialister sp. UW_FK_DIAL1_1 Pathway diu02024   Quorum sensing diu03018   RNA degradation Brite KEGG Orthology (KO) [BR:diu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     ACFWUL_03860 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     ACFWUL_03860 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:diu03019]     ACFWUL_03860 (hfq)    03036 Chromosome and associated proteins [BR:diu03036]     ACFWUL_03860 (hfq) Messenger RNA biogenesis [BR:diu03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      ACFWUL_03860 (hfq) Chromosome and associated proteins [BR:diu03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     ACFWUL_03860 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  XOQ31664 LinkDB All DBs Position 910070..910270 Genome browser AA seq 66 aa AA seqDB search MEGKLNLQDTFLNEARKENAPVAIFLMNGVQLKGRVKSFDSFTVLLVSENRSQLIYKHAI STIQRI NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atggaaggtaaactgaatctgcaggatacatttttaaatgaagcaaggaaggaaaatgca ccggtagccattttcctgatgaatggagtccagctgaagggccgggtcaagtcctttgac agctttacggttctcctggtcagcgaaaaccgttcccagctcatttataaacacgctata tcaacaattcaaaggatctga

DBGET integrated database retrieval system