Delphinapterus leucas (beluga whale): 111171121 Help Entry 111171121         CDS       T05885                                  Name (RefSeq) interferon alpha-1-like   KO K05414   interferon alpha Organism dle  Delphinapterus leucas (beluga whale) Pathway dle04060   Cytokine-cytokine receptor interaction dle04151   PI3K-Akt signaling pathway dle04217   Necroptosis dle04620   Toll-like receptor signaling pathway dle04621   NOD-like receptor signaling pathway dle04622   RIG-I-like receptor signaling pathway dle04623   Cytosolic DNA-sensing pathway dle04630   JAK-STAT signaling pathway dle04650   Natural killer cell mediated cytotoxicity dle04936   Alcoholic liver disease dle05152   Tuberculosis dle05160   Hepatitis C dle05161   Hepatitis B dle05162   Measles dle05163   Human cytomegalovirus infection dle05164   Influenza A dle05165   Human papillomavirus infection dle05167   Kaposi sarcoma-associated herpesvirus infection dle05168   Herpes simplex virus 1 infection dle05169   Epstein-Barr virus infection dle05170   Human immunodeficiency virus 1 infection dle05171   Coronavirus disease - COVID-19 dle05200   Pathways in cancer dle05320   Autoimmune thyroid disease dle05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:dle00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     111171121    04151 PI3K-Akt signaling pathway     111171121   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     111171121  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     111171121  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     111171121    04621 NOD-like receptor signaling pathway     111171121    04622 RIG-I-like receptor signaling pathway     111171121    04623 Cytosolic DNA-sensing pathway     111171121    04650 Natural killer cell mediated cytotoxicity     111171121  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     111171121   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     111171121    05161 Hepatitis B     111171121    05160 Hepatitis C     111171121    05171 Coronavirus disease - COVID-19     111171121    05164 Influenza A     111171121    05162 Measles     111171121    05168 Herpes simplex virus 1 infection     111171121    05163 Human cytomegalovirus infection     111171121    05167 Kaposi sarcoma-associated herpesvirus infection     111171121    05169 Epstein-Barr virus infection     111171121    05165 Human papillomavirus infection     111171121   09171 Infectious disease: bacterial    05152 Tuberculosis     111171121   09163 Immune disease    05320 Autoimmune thyroid disease     111171121   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     111171121   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     111171121  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dle04052]     111171121 Cytokines and neuropeptides [BR:dle04052]  Cytokines   Interferons    111171121 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon CoV_NSP2_N Motif Other DBs NCBI-GeneID:  111171121 NCBI-ProteinID:  XP_022422467 UniProt:  A0A2Y9MTZ8 LinkDB All DBs Position Unknown AA seq 133 aa AA seqDB search MTLDSPQEAFGGNQFQKAQAIAVVHEMIQQTFQLFSTEGSAAAWDETLLDKFCTALYQQL TELQACLMQEAGLEGTPLLKEDSILAVRKYFHRITVYLQENKYSPCAWETVRAEVMRSFS SSTNLQERLRRKE NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atgactttggattccccccaggaggcgtttggaggcaaccagttccagaaggctcaagcc atcgctgtcgtccatgagatgatccagcagaccttccagctcttcagcacagagggctcg gctgccgcttgggatgagaccctcctggacaagttctgcactgcactttatcagcagctc actgaactgcaagcctgtctgatgcaggaggcggggctggaagggactcccctgctgaag gaggactccatcctggctgtgaggaaatacttccacagaatcactgtctatctgcaagag aacaaatacagcccttgtgcctgggagactgtcagagcagaagtcatgagatccttctct tcatcaacaaacttgcaagaaagactcaggaggaaggaatga

DBGET integrated database retrieval system