KEGG   Delphinapterus leucas (beluga whale): 111182106
Entry
111182106         CDS       T05885                                 
Name
(RefSeq) integrin alpha-X-like isoform X1
  KO
K06462  integrin alpha X
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04610  Complement and coagulation cascades
dle04810  Regulation of actin cytoskeleton
dle05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111182106
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    111182106
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111182106
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:dle04515]
    111182106
   04090 CD molecules [BR:dle04090]
    111182106
Cell adhesion molecules [BR:dle04515]
 Integrins
  Integrin alpha subunits
   111182106
CD molecules [BR:dle04090]
 Proteins
  111182106
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_3 Integrin_alpha FG-GAP_2
Other DBs
NCBI-GeneID: 111182106
NCBI-ProteinID: XP_022443920
UniProt: A0A2Y9PD71
LinkDB
Position
Unknown
AA seq 1210 aa
MPMSDLPVMTRTRIFLLLSMALASSFCFNLDIDQPTTFHVDSAGFGYSVVQYANWLVVGA
PQEIKASNQTGGLYQCDYSMGKCEPILLPVPPEAVNMSLGLSMVATTSPFRLLACGPTVH
HACRENMHLTGFCFLLVSPSRQAQRIPAALQECPRQEQDIAFLIDGSGSISSTNFAKMLN
FVKAMMSQFQSPSSQFSLVQFSDKFQVHFTFKAFAASSNPLSLLNSVQKLSGYTYTATAI
RMVTEQLFSALYGARKDASKILIVITDGQKKRDPLDYKDVIPSAEAAGVIRYAIGVGLAF
QNIHSWQELKDIASKPSHEHIFKVENFDALRDIQNQLKEKIFAIEGTQTISSSSFELEMS
QEGFSAVFMPDGPVLGAVGSFSWSGGAFLYPPNRSPTFINMSQEHADMSDSYLGYSTEPA
IWKGVHSLVLGAPRHRHTGKVFIFTQVSGQWRPKAEVTGTQIGSYFGASLSSVDVDRDGG
SDLVLIGAPHYYEQSRGGQVSVCPFPRGRAKWQCGAVLRGEQGHPWGRFGAALTVLGDVN
GDRLTDVAIGAPGEQENQGAVYLFHGTSGLGIIPAHSQRVTGAQFSPSLQYFGQSLSGGQ
DLTMDGLVDLAVGAWGHALLLRTRPVLRVWANIHITPPEITRSVYECHQQLAFAQSLGEA
TVCLRVSQSPKNRLANLQSVVTFDLTLDPGRLSPRAVFEETRTRNLIRVRDLGLTQHCEP
VRLLLPACVEDSVTPIILRLNFSLVGKPVSGFGNLKPMLAVDAQRYFMASLPFEKNCGAD
HVCQDDLGISFGVSGLKTLIVGSNLELSLEVRVWNDGEDSYGTTITFFYPPGLSYRRVAG
GQNQLQSRALRLTCDSAPTGSQGTLSTSCSINNLIFREGAQITFRATFDVSPTAMLGGRL
LLAANVSSENNAPKMSKTTFRLELPVKYAVYTMISSHEQSTKYLNFSASEEEESSGAQHR
YQVNNLGHRDLPVSIDFSVPVELNRLTVWKDMEVLHPQNPSIQCSSGRTVPTESDFLTHF
QKKPVLDCSIAACLRFRCDIRSFGIQEKLDFILKGNLSFGWVSQTLQKKVLVVSVAEITF
NRSVYSQLPGQEAFLRAQMELVLEKYEVYNPIPIIVGSSVGGLLLLALITAILYKVGFFK
RQYKEMMEGANGQTAPEDGTGDPQVAQYKRNTSRFSPSLHCCSAPMSPHFWTQGAISREH
VGGLPWRSSG
NT seq 3633 nt   +upstreamnt  +downstreamnt
atgccgatgtctgacctcccagtcatgaccaggaccaggattttcctcctcctgtcgatg
gccctggcttcctctttctgcttcaacttggacatagaccagccaacaaccttccatgtg
gacagcgctgggtttggatacagcgtggtccagtatgccaactggctggtggttggagcc
ccccaggagataaaggcttccaatcaaacgggcggcctttaccagtgcgactacagcatg
ggcaagtgtgaacccatcctccttccggtgcctccagaggctgtgaacatgtccctgggc
ctgtccatggtggccaccaccagcccctttcggctgctggcctgtggccccaccgtgcac
catgcatgcagggagaacatgcacttgaccgggttttgcttcctgctggtctccccatcc
cggcaggcccagaggatcccggctgccctgcaggagtgcccgaggcaggagcaggacatt
gccttcctgatcgatggttcaggcagcatctcctccaccaattttgccaaaatgctgaac
ttcgtgaaggctatgatgagccagttccagagccccagctcccagttctccctggtgcag
ttctccgacaagttccaggtgcacttcactttcaaagctttcgcagccagctcaaaccca
ctaagcctgctgaactccgtacagaagctgagtgggtacacgtacacggccacggccatc
aggatggtcacagaacagctgttcagtgccttatatggggcccgaaaagatgcctccaaa
atcctcatcgtcatcaccgatgggcagaaaaaacgtgaccctctggattacaaggacgtc
attcccagtgctgaggctgctggcgtcatccgctatgcaatcggggtgggattggctttt
caaaatatacattcctggcaagaattaaaggacatcgcatcgaagccctcccatgaacat
atatttaaagtggagaactttgatgctttgagagacattcaaaaccaactgaaagagaag
atctttgccattgagggtacgcagactataagcagtagttccttcgaactggagatgtcc
caggagggcttcagtgctgtgttcatgcctgatggaccagttctgggggctgtggggagc
ttcagctggtctggaggtgccttcctgtaccccccaaataggagccccaccttcatcaac
atgtctcaggagcacgcagacatgagtgactcttacctgggttactccacagagccggcc
atttggaagggggtacacagcctggtcctgggagccccccgccatcggcacaccgggaag
gttttcatcttcacgcaggtgtccgggcaatggaggccgaaggctgaagtcacagggacc
cagatcggctcctacttcggggcctccctcagctccgtggacgtggacagagatggcggc
tccgacctggtcctcatcggggccccccattactatgagcagagccggggcgggcaggtg
tccgtgtgcccctttcctcgggggagggctaagtggcagtgtggtgctgtcctgcgaggg
gagcaaggccacccctggggccgctttggggcagctctgacggtgctgggggatgtgaac
ggggacaggctgacggacgtggccattggggccccgggagagcaggagaaccagggtgct
gtctacctgtttcacggaacctcgggactgggcatcatccccgcccacagccagcgggtc
acaggcgcccagttctcccccagcctccagtattttgggcagtcgctgagcgggggtcag
gacctcaccatggatggactggtggacttggctgtgggggcctgggggcacgcgctgctg
ctcaggacgagacctgtgcttagggtgtgggcaaacatccacatcacacctccagagatc
actaggtctgtgtatgaatgccaccagcagctggcctttgcccagtctctgggtgaggcc
actgtctgccttcgtgtttctcaaagtcccaagaaccggctggctaacctccaaagcgtt
gtgacctttgacctaacccttgaccctggccgcctgagtcctcgtgctgtcttcgaggag
acaaggactcggaatctgattcgtgttcgagatctggggctgacacagcactgtgagccc
gtgaggttgctcctgccggcctgtgtggaggactcggtgacccccatcatcttgcgtctc
aacttctccctagtgggcaagcctgtctctggctttggaaacctcaagcctatgctggca
gtggatgcccagagatacttcatggcctctctcccctttgagaagaactgtggtgccgat
cacgtctgccaggacgacctcggcatctcctttggggtctcaggcttgaagaccctgatt
gtggggagtaacctggagctgagcttggaagtgagagtgtggaatgatggagaggactcc
tatggaaccacaatcaccttcttctacccgccggggctatcttatcgacgtgtggcaggg
gggcagaaccagctgcagtcacgtgccctgcgcctgacctgtgacagtgcccccaccggg
agccagggcactctcagcaccagctgtagcatcaacaacttaatcttccgtgagggcgcc
cagatcaccttcagggccacctttgacgtctcccccacggccatgctgggaggccggctg
cttcttgcagccaatgtaagcagtgagaataacgcccccaagatgagcaagaccaccttc
cggctggagctcccggtgaagtatgccgtgtacaccatgatcagcagccatgaacaatcc
accaagtacctcaacttctcagcctctgaggaggaggaaagcagcggggctcagcacaga
taccaggtgaacaacctgggacacagggacctgcctgtcagcattgacttctcagtgccc
gtggagctgaaccggttgaccgtgtggaaggatatggaggtcctccaccctcagaaccca
tccattcagtgctcttcagggagaacagtgcccacagaatccgacttcctgacccacttt
cagaagaagcctgtcctggactgctctattgctgcctgcctgaggttccgctgtgacatc
cgctccttcggcatccaggagaaacttgacttcatcctgaaaggaaatctcagcttcggc
tgggtcagccagacactgcagaagaaggtgttggttgtgagtgtagctgagatcacattc
aacagatccgtgtattcccagcttccaggacaggaggcatttttgagagcccagatggag
ctggtgctggagaagtatgaggtctataaccccatccccattattgtgggcagctctgtg
ggaggactgctgctgctggctctcatcacagccatactgtacaaggttggcttcttcaaa
cgtcagtacaaggaaatgatggagggagcaaatggacagactgctccagaagatgggaca
ggagacccccaagttgcccagtacaaaaggaacacgtctagattcagcccatctctgcat
tgctgcagtgcccccatgtcccctcatttctggacccaaggggccatctcaagagagcat
gtggggggacttccctggcggagcagtggttaa

DBGET integrated database retrieval system