KEGG   Drosophila melanogaster (fruit fly): Dmel_CG10847
Entry
Dmel_CG10847      CDS       T00030                                 

Gene name
enc
Definition
(RefSeq) encore, isoform D
  KO
K02360  a component of the cytoplasm (encore)
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04320  Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dme00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04320 Dorso-ventral axis formation
    Dmel_CG10847 (enc)
SSDB
Motif
Pfam: R3H SUZ
Other DBs
NCBI-GeneID: 44543
NCBI-ProteinID: NP_001097496
FlyBase: FBgn0004875
UniProt: Q8MSX1
LinkDB
Position
3L
AA seq 1818 aa
MSSTKSQVALATNIPTNLSSAASASTAAAAAAVVVVASANAAVASSANSSGVGSGSGPGP
GSGAGVSGPVAAGTATAVATGSTVTAATSVAATTSTSVATISTSCSSSSINNINNNCGEE
CQSAAGSSNLGRQNSFGNRRGNMKGKHLTRSHAMRESTSPPRTPTPRAASEQQQQQLQGE
QHEHNNNNNINSSSKAQSAGRGNSPLMETPAVIVTSQQPQQQQQQQQQQQQSVPPKPQQN
VPLSNEAEFPKLSPPKKSGGQHNRTNSNGSGMEFNNNNNSSNKKFVVDMKANGLDNKPHN
NSSTGVIFNSGMNYKAAERHDRHERHEMSSQNSNLSNNHDEEPYHYEPRGGGGGKKHRAN
TNAKGNKPRLKNLGGSSSGSIDLGGGGGNGNCNNMSNNGQSNNSSNNTSGFISRENSSEQ
YTDYGGTDLLVFFRDTLNKNPKDRNILLKIEKDLIDFVQENSRGCEYRFPPASSYNRMLI
HRTAAFFGMEHNVDTETQQCVIVAVAKNTRIPEIRFQSLVRDDARKSILKRDTHSFDEVR
QSPYLCPLSLDRKAKSFEEREEDYDRARSRIFSRTGGNHDGYSGGGGDEECYGGWEQQQQ
QQKQSQPPRPKRPNGKMLQMQNSTESRDGMRSGGAVPKSHNFGNYGGPPSSGGPGNNSLP
RGDSTNSIKSGRGGFVKQDSTGSTPWRLSPSSSGSIYHYDPSNLPPNQALQHSGNQYQSQ
NQGNSSSGGYNNYRKSSPHQQQQSQQQQQSQQHHQQQLQQPQQLHQQSSQQYATTELSCS
STESYAEEEAQSPGMECSEGYESYEQQSLPVQQQLSGNGDSASTKGDDCDSLASATACLS
ITTSTSTKNYDRIEVQKYKNQATSPNIPACCAVGEKLELEAGLPQEQEQEPMAGPSSSGS
ATSSVGITELPSSQTPLPMVNQVNCDLQSVSPSTTPYSQCEVKTPSQNHAPSAAVEEPKT
TTWTYTQSYQAPDGSTVFHTTTTPNGAAPYCATTYQQGPDGSIYAVPQGMVYAAYPQPGV
GTAGGASQPLFQLTTSSHPPAQTIFASPEAGAEIPGGTYMIPVFDPAQQPREGLIPAQAI
YQTGPGGPGATTVMPMATAAAYPTAQFATAAPNGAPIYQAPLIYSSEPGGGAQLQQLPMA
PYPIQYSYPYYHPISYYVPQQAVAAAPMVASQPQVGQAPMQQQAPHTGAGTTTGPPTVVS
VSGQQHHQPHQQHHQQQQHSSNGSVVTSSAYGTRVKRTPGGGSIHYNPSYTPSSVAHAGG
AHHPSAGSAQIIAAPAASTTTYHALPTLTLAHGGPATGTDLSGAGGAHVYALPAQHALIP
TNIFPYAAAAAAAAGGPGGPPTTPQVVQQAPPPPPQSAPHHALITAAPFYPANGGNMDQG
ASQSAPSTPAAPGRQAPLFSTPPAPNNGSSGSSSAGGGGNSGGYHSNSSTPHYYQGQNSN
EGYTSPYEKRNHGGGASGAHSVGVRKPYHPGGYNPRHSVPLGGIPSGAKTPLLNSNNEPT
PRASPSSVSLGGASSSGGANSYPHRGPPPHTMGVKRDNKPNQLPLISGPPPSYAANSSPG
VSSYESKPPVRLNAGAASFRSQKSMNQDYRRSVSQRNSPSANGGGSGSHESSNNSPNSIV
GSQSNSAANTPNAAAPPPPQPQPTLVSHSGGFVVLDQTTGAAMNASPPSLYGGGGGPNAG
ISGGAGASGAAGSNGGHQPGGGGGARSHIPTAQLHHSAAAAAAAAAGSQQATAAVLSGVA
AAAALGGYNPNGASGVYFKYGQTYFAHPSVALPNSRRSPSNDIRPQMAQVAGMYPTMMIQ
ARHPSRHPNPNYKGSRPR
NT seq 5457 nt   +upstreamnt  +downstreamnt
atgagttccacaaaatctcaagtagccctagctacgaatattccaaccaatttatcctcc
gccgcttctgcctcaacagcggccgctgcggccgccgttgttgttgttgccagtgccaac
gccgccgttgcctcaagcgccaactcatcgggagtgggttcaggatcgggaccgggaccg
ggatcgggagcaggagtatcaggaccagtagccgcaggcacagccactgccgtagcaaca
ggatcaacagtcacagcagcaacatccgtcgcggcaacaacctccacttccgttgccaca
atctcaaccagctgcagcagcagcagcatcaacaacatcaacaacaactgcggcgaggag
tgccagtcggcggccggatcctccaacttgggtcgacagaacagcttcggcaatagacga
ggcaacatgaagggcaaacatctgacgcgcagccatgccatgcgtgagtccacttcgcca
cctcgcacgccaacgccgcgggctgcctccgagcagcagcaacagcagctccagggggaa
caacacgagcataacaataataacaatatcaacagcagcagcaaagcacaatcagctgga
aggggcaactcgccgttgatggagacgccagccgtgattgtcactagtcagcaaccgcaa
cagcagcagcaacagcagcagcaacagcagcagagtgtgccaccaaagccgcagcagaat
gtgccactcagcaatgaagcggagttcccaaagctatcgcctccaaagaaatccggcggt
cagcacaatcgcaccaacagcaacggcagcggcatggagtttaataacaataataacagt
agtaacaagaaattcgtcgttgatatgaaggccaatggtttggacaacaagccacacaac
aactcgtctacgggtgtgatcttcaactccgggatgaactacaaggcggcggagcggcat
gatcgtcacgagcgccacgagatgtccagccagaacagcaatctgagcaacaaccacgac
gaggagccgtatcactatgagcccagaggtggaggaggcggcaagaagcatcgtgccaac
accaatgccaaaggtaataaaccacggttgaagaatctcggtggaagctcatctggcagc
attgatttaggaggcggcggtggaaacggaaattgcaacaacatgtccaacaatggccaa
tccaacaactcgagcaacaacacctcgggctttatatcgcgcgagaactcgagcgagcag
tacacggactatggcgggaccgatctactggttttcttccgggacaccctcaacaagaac
cccaaggatcgcaatatcctcttgaagattgagaaggacctaatagactttgtccaggaa
aatagtcgtggctgtgagtaccgttttccgccagcttcctcgtacaatcgtatgctgatc
catcgcactgccgcattcttcggcatggagcacaatgtggacacggagacgcagcagtgt
gtgattgtggccgtggccaagaacactcgcataccggagatccgcttccagtcgctggtg
cgcgacgatgcacgcaagtcaattctgaagcgggacacgcacagcttcgatgaggtgcgt
cagtcaccgtacttgtgccctctttctctggatcgaaaggccaagagcttcgaggagcgg
gaagaggactacgatagagcgcgcagccgcatcttcagtcgaacagggggcaatcatgac
ggttactccggaggtggtggcgacgaggaatgctacggtggttgggagcagcagcaacaa
cagcagaagcagtctcagccacccagacccaagaggcccaatggaaagatgttgcagatg
caaaattccacggaatctcgcgatggcatgcgatccggtggagccgtgcccaagtcgcac
aactttggcaactacggaggtccgcccagctcaggaggtcctggcaacaattccttgcct
cgtggcgactcaacaaactcgatcaaaagcggacgcggcggcttcgtcaagcaggactca
actggcagcactccatggcgcctgtctccttccagcagtggttccatttaccactacgac
ccgtccaacctgccgcccaaccaggcgctccagcactcgggcaatcaataccagtcacag
aaccagggcaactcctcatccggcggctataacaactatcgcaagtcgtcgccacatcaa
cagcaacagtcgcagcagcagcaacagtcacagcagcatcatcagcagcaattgcagcag
ccacagcagctgcatcagcagtcatcacagcaatatgccaccactgagctgtcctgcagc
tccaccgagagctatgcggaggaggaggcgcagtccccaggaatggagtgttctgaggga
tacgagagctacgagcagcagtcgttgcctgttcagcagcagctttccggcaacggggat
tcggccagcaccaagggagatgattgtgatagcctggccagtgctaccgcctgcctcagc
atcaccacctccacatccacaaagaactacgaccgcatcgaggtgcagaagtacaagaac
caggccactagtccgaacatacccgcctgctgcgccgtgggcgaaaagcttgaactggag
gctggcttgccgcaggagcaggaacaggaacctatggctggaccctcctcttccggttcc
gccacctcctcggtgggcattaccgagctcccatccagccagacaccgctcccaatggtg
aatcaggtgaactgtgacctccaatcggtctcgcccagcaccacgccctacagccagtgc
gaggtgaaaactcctagccagaaccatgcacccagtgccgccgtcgaggagcccaagacc
accacctggacgtacacgcagagctaccaggcgccagacggctctaccgtctttcacact
accactacgcccaatggggctgcgccctactgcgccaccacatatcagcaggggcccgat
ggcagcatctatgcggttccgcagggcatggtttatgccgcctacccgcaaccaggcgta
ggcactgccggtggtgcctctcagccgctcttccaacttaccaccagcagtcacccgccc
gctcagacaatttttgcatccccggaggcaggcgcagagattcctggaggcacctacatg
atacctgtctttgatccggctcagcagccgcgtgagggactcatcccggcgcaggccata
taccagacggggccgggcggaccgggagccaccaccgtgatgccaatggcgacggcggct
gcctatccaacggcccagttcgccacagcggctccaaatggcgcgccgatataccaggcg
ccgcttatctactccagtgaaccgggaggtggagcacagctgcaacagcttcccatggca
ccgtatccgattcaatactcttacccgtactaccatcccatctcgtactatgtgccccag
caggcagtggccgccgcaccgatggtagcctcccagccgcaggtgggtcaggctccgatg
caacagcaggcgccgcacacgggagctggaacaaccacaggtccaccaacggtggtttca
gtttcaggccaacaacaccaccagccgcatcagcagcaccatcagcagcagcagcactcg
agcaatggatccgtggtcacatccagtgcctatggcactcgggttaagcgcacaccaggc
ggtggctcgatccactacaacccaagctacacaccaagttctgtggctcatgccggtggt
gcccatcatccgtcagcgggctctgcccagataatcgctgcgcctgcggccagcacaacc
acatatcatgcgctgcctacgctgacgctagcccacggtggtccagcgactggcacggat
ctcagtggagcgggtggtgcccatgtttatgctctccccgcccaacacgcgctgatccca
acgaatatcttcccttatgcagcggcggcggcggcagccgccggagggccagggggtcct
ccaacgactccccaggtggtgcagcaggcaccaccaccaccgccacagagtgctccccat
catgctcttatcacagcggctccgttttatcctgcaaatggcggtaacatggatcagggt
gcctctcagtcggctcctagcactccagcggctcctggaagacaagcgccgttgttcagc
acaccaccggcaccaaacaatggaagcagtggcagcagcagtgcgggaggcggtggaaac
agcggtggctatcacagcaacagctccacgccgcactactaccagggccagaacagcaac
gagggttacacctcgccttatgagaagagaaatcatggaggtggagcctcaggagcacac
tcggtgggagtgcgtaagccttaccacccaggtggctacaacccaagacattcggtacca
ctagggggcatcccctctggagcaaagactcccttgctgaactccaacaacgagcccacg
ccgcgtgcctctcccagcagcgtaagtctgggtggtgcttcttcatccggtggggccaat
tcctacccacatcgtgggccaccaccacacacgatgggtgtgaaacgagataacaagccc
aaccaactgccgctgatcagtggaccaccgcctagttatgcagctaactcgagccctgga
gtttccagctacgagtccaagccaccggtgcgcctaaatgccggagctgctagtttccgg
agtcagaagtccatgaaccaggactaccgacgcagtgtctcccaacgtaactcgcccagc
gccaatggaggtggaagtggcagccacgagagcagcaacaactcgcccaacagtattgtg
ggcagccagagcaacagtgctgccaacacgcccaacgcagcagccccaccaccaccgcag
ccacagcctacgctggttagccactctggaggatttgtggtgctggatcagaccaccgga
gccgccatgaatgcctcgccgccgtcgctctatggtggcggtggaggtccaaatgcagga
ataagtggaggagcaggcgcttcgggagcggcaggctcgaatggtggccatcagccgggt
ggcggcggtggcgcccgctcgcacattcccactgcccagctgcatcacagtgccgccgct
gccgccgccgcagctgctggcagccaacaggcaacggcggcggtgctgagcggcgtggcc
gctgctgccgccctcggcggctacaatccaaatggggcgtccggtgtctacttcaagtat
ggccagacgtactttgcccatccctcggtggccttgcccaacagtcgacgatctccgtcg
aacgatatccggcctcaaatggcgcaagtggccggcatgtatcccacaatgatgatacaa
gcgcgtcatccgagtcgccatccgaacccgaactacaaaggttcgcgtccgcggtaa

DBGET integrated database retrieval system