KEGG   Drosophila melanogaster (fruit fly): Dmel_CG11941
Entry
Dmel_CG11941      CDS       T00030                                 

Gene name
SkpC
Definition
(RefSeq) SKP1-related C
  KO
K03094  S-phase kinase-associated protein 1
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04120  Ubiquitin mediated proteolysis
dme04141  Protein processing in endoplasmic reticulum
dme04310  Wnt signaling pathway
dme04341  Hedgehog signaling pathway - fly
dme04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dmel_CG11941 (SkpC)
   04120 Ubiquitin mediated proteolysis
    Dmel_CG11941 (SkpC)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG11941 (SkpC)
   04341 Hedgehog signaling pathway - fly
    Dmel_CG11941 (SkpC)
   04350 TGF-beta signaling pathway
    Dmel_CG11941 (SkpC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dme04121]
    Dmel_CG11941 (SkpC)
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG11941 (SkpC)
Ubiquitin system [BR:dme04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     Dmel_CG11941 (SkpC)
   Cul7 complex
     Dmel_CG11941 (SkpC)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     Dmel_CG11941 (SkpC)
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     Dmel_CG11941 (SkpC)
SSDB
Motif
Pfam: Skp1_POZ Skp1
Other DBs
NCBI-GeneID: 32996
NCBI-ProteinID: NP_608358
FlyBase: FBgn0026175
UniProt: Q9VWC4
LinkDB
Position
X
AA seq 158 aa
MDAPTIKLESSDGMIFSTEVRAAKLSETIKTMLEVSAVENDENAIVPLPKVNAFILSKIL
TWIYHHKDDDAHGAEGVELSPQSPHDISAWDANFINVDQPTLFEIILAANYLEIKGLVDL
CCKTVANMIRGKTPEEIRHTFNIPDEIPSRTAQLGEDL
NT seq 477 nt   +upstreamnt  +downstreamnt
atggatgctcccaccatcaagcttgagtcctcggatgggatgatcttttcaacggaagtc
cgagccgccaagctctccgaaaccatcaagaccatgttggaggtctctgccgtggagaac
gacgagaatgccattgtgccgctgcccaaggtgaacgcgttcatcctatccaagattctg
acctggatctatcaccacaaggacgatgatgcccatggagcggagggcgtggagttgagc
ccgcaaagcccacatgacatctcagcctgggacgccaactttattaacgtcgatcaaccc
accttgttcgaaatcatactggccgccaactatctggagatcaagggcctagtggatctc
tgttgcaagacggtggccaatatgattaggggaaagactcccgaggagatccgccacacg
ttcaacatcccggacgaaataccgagcaggacggcccagttgggcgaagacctgtga

KEGG   Drosophila melanogaster (fruit fly): Dmel_CG11942
Entry
Dmel_CG11942      CDS       T00030                                 

Gene name
SkpE
Definition
(RefSeq) SKP1-related E
  KO
K03094  S-phase kinase-associated protein 1
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04120  Ubiquitin mediated proteolysis
dme04141  Protein processing in endoplasmic reticulum
dme04310  Wnt signaling pathway
dme04341  Hedgehog signaling pathway - fly
dme04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dmel_CG11942 (SkpE)
   04120 Ubiquitin mediated proteolysis
    Dmel_CG11942 (SkpE)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG11942 (SkpE)
   04341 Hedgehog signaling pathway - fly
    Dmel_CG11942 (SkpE)
   04350 TGF-beta signaling pathway
    Dmel_CG11942 (SkpE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dme04121]
    Dmel_CG11942 (SkpE)
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG11942 (SkpE)
Ubiquitin system [BR:dme04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     Dmel_CG11942 (SkpE)
   Cul7 complex
     Dmel_CG11942 (SkpE)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     Dmel_CG11942 (SkpE)
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     Dmel_CG11942 (SkpE)
SSDB
Motif
Pfam: Skp1_POZ Skp1
Other DBs
NCBI-GeneID: 32997
NCBI-ProteinID: NP_608359
FlyBase: FBgn0031074
UniProt: Q9VWC3
LinkDB
Position
X
AA seq 167 aa
MVTPTIKLESSEGVIFPTEVRVAMVSETIKTMLDHFAVQNDENAIVPLHSVSTFTLGKIL
AWANHHKDDDDQSTEGEELKPRRPYAISPWDAIFLMVNSTTLLEIILAAKQLQIKGLLEL
TYNVVANMIRGKTPEEIRFIFNIPEDVSPSVDGELRWKDLFLWPMDF
NT seq 504 nt   +upstreamnt  +downstreamnt
atggttactcccaccatcaagcttgagtcctcggaaggggtgatctttccgacggaagtc
cgagtcgccatggtctccgaaaccatcaagaccatgttggatcactttgccgtgcagaac
gacgagaatgccatcgtgcccctgcactcggtgagcacgttcaccctgggcaagattcta
gcctgggccaatcaccacaaggacgatgatgatcagtcaacggagggtgaggagctgaag
ccacgtcgcccatatgccatctccccatgggacgccatcttcttgatggtcaattcaacc
accttgctcgaaatcatactggccgccaaacaactgcagatcaagggcctactggaactc
acctacaatgtggtggccaatatgattaggggcaagactcccgaggagatccgcttcatc
ttcaacattccggaagacgtctcgccatccgtggacggggagttgagatggaaagacctg
tttttgtggcccatggatttctga

KEGG   Drosophila melanogaster (fruit fly): Dmel_CG12227
Entry
Dmel_CG12227      CDS       T00030                                 

Gene name
SkpF
Definition
(RefSeq) SKP1-related F
  KO
K03094  S-phase kinase-associated protein 1
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04120  Ubiquitin mediated proteolysis
dme04141  Protein processing in endoplasmic reticulum
dme04310  Wnt signaling pathway
dme04341  Hedgehog signaling pathway - fly
dme04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dmel_CG12227 (SkpF)
   04120 Ubiquitin mediated proteolysis
    Dmel_CG12227 (SkpF)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG12227 (SkpF)
   04341 Hedgehog signaling pathway - fly
    Dmel_CG12227 (SkpF)
   04350 TGF-beta signaling pathway
    Dmel_CG12227 (SkpF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dme04121]
    Dmel_CG12227 (SkpF)
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG12227 (SkpF)
Ubiquitin system [BR:dme04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     Dmel_CG12227 (SkpF)
   Cul7 complex
     Dmel_CG12227 (SkpF)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     Dmel_CG12227 (SkpF)
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     Dmel_CG12227 (SkpF)
SSDB
Motif
Pfam: Skp1_POZ Skp1 Cyclin_N
Other DBs
NCBI-GeneID: 37713
NCBI-ProteinID: NP_611796
FlyBase: FBgn0034863
UniProt: Q9W1Q0
LinkDB
Position
2R
AA seq 171 aa
MPVIKLQSSDGEIFETDIETAKCSSTIKTLLEDCPVEAENDTLIPLPNVNSTILKKVLIW
AKHHREDIAEENEEEAAKSVAVQITPWDAEFLSMDQGTLFELILAANYLDIPNLLNAACM
TVANMIKGRTTEEIRQTFHITNDFSPSEEDLMTMESEVPQEDEAIEYGEII
NT seq 516 nt   +upstreamnt  +downstreamnt
atgccagtcatcaaattgcagtcctccgatggcgaaattttcgagaccgacatcgagact
gccaagtgctcgagcaccattaagaccctattggaggattgtccagtggaagcggagaac
gacactcttatcccgctgcccaatgtgaactcgacgatcctgaagaaggtcctcatttgg
gccaagcatcatcgcgaggacattgcagaggagaacgaagaggaagcggccaagtccgtc
gctgtgcagatcaccccctgggacgccgagttcctgtccatggatcagggcacgctcttc
gaactcatcttggcggccaactacctggacattcccaatctgctgaacgccgcctgcatg
acggtggccaacatgattaaaggccgcacgacggaggagattcgccagacctttcacata
accaacgatttctcgccctccgaggaggatttgatgacgatggagtcggaagtcccgcag
gaggacgaggcgatagagtacggcgaaattatataa

KEGG   Drosophila melanogaster (fruit fly): Dmel_CG12700
Entry
Dmel_CG12700      CDS       T00030                                 

Gene name
SkpD
Definition
(RefSeq) SKP1-related D
  KO
K03094  S-phase kinase-associated protein 1
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04120  Ubiquitin mediated proteolysis
dme04141  Protein processing in endoplasmic reticulum
dme04310  Wnt signaling pathway
dme04341  Hedgehog signaling pathway - fly
dme04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dmel_CG12700 (SkpD)
   04120 Ubiquitin mediated proteolysis
    Dmel_CG12700 (SkpD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG12700 (SkpD)
   04341 Hedgehog signaling pathway - fly
    Dmel_CG12700 (SkpD)
   04350 TGF-beta signaling pathway
    Dmel_CG12700 (SkpD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dme04121]
    Dmel_CG12700 (SkpD)
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG12700 (SkpD)
Ubiquitin system [BR:dme04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     Dmel_CG12700 (SkpD)
   Cul7 complex
     Dmel_CG12700 (SkpD)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     Dmel_CG12700 (SkpD)
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     Dmel_CG12700 (SkpD)
SSDB
Motif
Pfam: Skp1_POZ Skp1
Other DBs
NCBI-GeneID: 32995
NCBI-ProteinID: NP_608357
FlyBase: FBgn0026174
UniProt: Q9VWC5
LinkDB
Position
X
AA seq 158 aa
MDAPTIKLESSDGVIFSTEVKAAKLSETIKTMLEVSAVENDENAVVPLPKVNAFILNKIL
TWAYHHKDDDDQAAEGEELTPQSPHDISPWDANFINVDQPILFEITVAANYLEIKGLEDL
CCKTLANMIRGKTPEEIRQTFNIEDDLPIDTAELGEDL
NT seq 477 nt   +upstreamnt  +downstreamnt
atggatgctcccaccatcaagcttgagtcctcggatggggtgatcttttcaacggaagtc
aaagccgccaagctctccgaaaccatcaagaccatgttggaggtctctgccgtggagaac
gacgagaatgccgttgtgccgctgcccaaggtgaacgcgttcatcctaaacaagattctg
acctgggcctatcaccacaaggacgatgatgaccaggcagcggagggcgaggagttgacc
ccgcaaagcccacatgacatctcaccctgggacgccaactttattaacgtcgatcaaccc
atcttgttcgaaattacagtggccgccaactatctggagattaagggcctagaggatctc
tgttgcaagacgttggccaatatgattaggggaaagactcccgaggagatccgccagacg
ttcaacatcgaagacgatttaccgatcgatacggccgagttgggcgaagacctgtga

KEGG   Drosophila melanogaster (fruit fly): Dmel_CG15800
Entry
Dmel_CG15800      CDS       T00030                                 

Gene name
CG15800
Definition
(RefSeq) uncharacterized protein
  KO
K03094  S-phase kinase-associated protein 1
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04120  Ubiquitin mediated proteolysis
dme04141  Protein processing in endoplasmic reticulum
dme04310  Wnt signaling pathway
dme04341  Hedgehog signaling pathway - fly
dme04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dmel_CG15800 (CG15800)
   04120 Ubiquitin mediated proteolysis
    Dmel_CG15800 (CG15800)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG15800 (CG15800)
   04341 Hedgehog signaling pathway - fly
    Dmel_CG15800 (CG15800)
   04350 TGF-beta signaling pathway
    Dmel_CG15800 (CG15800)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dme04121]
    Dmel_CG15800 (CG15800)
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG15800 (CG15800)
Ubiquitin system [BR:dme04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     Dmel_CG15800 (CG15800)
   Cul7 complex
     Dmel_CG15800 (CG15800)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     Dmel_CG15800 (CG15800)
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     Dmel_CG15800 (CG15800)
SSDB
Motif
Pfam: Skp1_POZ
Other DBs
NCBI-GeneID: 37763
NCBI-ProteinID: NP_611828
FlyBase: FBgn0034904
UniProt: Q9W1J7
LinkDB
Position
2R
AA seq 157 aa
MVRFETRDGRTISVNLALLEKSLVIREMCRVGQVPEDEDFVLPLHGIHSNVLLKILLWAE
YHEKHEEPAWVDSKDPLPAEEIELQISDWDKEFLRVEIDSICKIMEGCNYLDIPWLYKLC
AQKLVFLSSREPETQFSGYVEKIPRFQDHFIEQIQKE
NT seq 474 nt   +upstreamnt  +downstreamnt
atggtgcgattcgagacaagggatggccgtacgataagcgtaaatctggctctgctcgag
aaatccttggtgatccgggagatgtgccgcgttggccaggtcccagaggatgaggacttc
gtcctgccgctgcacggtatacacagcaatgtcctgctgaagatcttgctgtgggctgag
taccatgagaaacacgaagagcccgcctgggtggacagcaaagatcctcttccggccgag
gagattgagctgcagatctccgattgggacaaggagttcctgcgcgtggaaatcgatagc
atttgcaaaatcatggagggctgcaactacttggacatcccttggctctacaagctctgt
gcccagaaactcgtcttcctcagcagccgagagccggagacgcagttcagcggttacgtg
gagaagatcccaagattccaggatcatttcattgagcaaattcaaaaggaatag

KEGG   Drosophila melanogaster (fruit fly): Dmel_CG16983
Entry
Dmel_CG16983      CDS       T00030                                 

Gene name
SkpA
Definition
(RefSeq) SKP1-related A, isoform H
  KO
K03094  S-phase kinase-associated protein 1
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04120  Ubiquitin mediated proteolysis
dme04141  Protein processing in endoplasmic reticulum
dme04310  Wnt signaling pathway
dme04341  Hedgehog signaling pathway - fly
dme04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dmel_CG16983 (SkpA)
   04120 Ubiquitin mediated proteolysis
    Dmel_CG16983 (SkpA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG16983 (SkpA)
   04341 Hedgehog signaling pathway - fly
    Dmel_CG16983 (SkpA)
   04350 TGF-beta signaling pathway
    Dmel_CG16983 (SkpA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dme04121]
    Dmel_CG16983 (SkpA)
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG16983 (SkpA)
Ubiquitin system [BR:dme04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     Dmel_CG16983 (SkpA)
   Cul7 complex
     Dmel_CG16983 (SkpA)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     Dmel_CG16983 (SkpA)
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     Dmel_CG16983 (SkpA)
SSDB
Motif
Pfam: Skp1 Skp1_POZ BTB
Other DBs
NCBI-GeneID: 31016
NCBI-ProteinID: NP_001033818
FlyBase: FBgn0025637
UniProt: O77430
LinkDB
Position
X
AA seq 162 aa
MPSIKLQSSDEEIFDTDIQIAKCSGTIKTMLEDCGMEDDENAIVPLPNVNSTILRKVLTW
AHYHKDDPQPTEDDESKEKRTDDIISWDADFLKVDQGTLFELILAANYLDIKGLLELTCK
TVANMIKGKTPEEIRKTFNIKKDFSPAEEEQVRKENEWCEEK
NT seq 489 nt   +upstreamnt  +downstreamnt
atgcccagcatcaagttgcaatcttcggatgaggagatctttgacacggatatccagatc
gccaagtgctccggcactatcaagaccatgctggaggactgcggcatggaggacgatgag
aatgccattgtgccgttgcccaatgtgaattcgacgattcttcgcaaggtgcttacctgg
gctcactaccacaaggacgacccccagccaacggaggatgatgagagcaaggagaagcgc
acagacgacattatctcatgggatgcagatttcctaaaagtcgaccagggcacactgttt
gagctgatattggcagcgaactatctggacattaagggccttctggagctcacctgcaag
actgttgcaaacatgattaagggaaagactcccgaggaaatacgcaagaccttcaacatt
aagaaggacttttcgcccgccgaggaggagcaggtgcgcaaggagaacgagtggtgcgag
gagaagtaa

KEGG   Drosophila melanogaster (fruit fly): Dmel_CG43089
Entry
Dmel_CG43089      CDS       T00030                                 

Gene name
CG43089
Definition
(RefSeq) uncharacterized protein, isoform B
  KO
K03094  S-phase kinase-associated protein 1
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04120  Ubiquitin mediated proteolysis
dme04141  Protein processing in endoplasmic reticulum
dme04310  Wnt signaling pathway
dme04341  Hedgehog signaling pathway - fly
dme04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dmel_CG43089 (CG43089)
   04120 Ubiquitin mediated proteolysis
    Dmel_CG43089 (CG43089)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG43089 (CG43089)
   04341 Hedgehog signaling pathway - fly
    Dmel_CG43089 (CG43089)
   04350 TGF-beta signaling pathway
    Dmel_CG43089 (CG43089)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dme04121]
    Dmel_CG43089 (CG43089)
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG43089 (CG43089)
Ubiquitin system [BR:dme04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     Dmel_CG43089 (CG43089)
   Cul7 complex
     Dmel_CG43089 (CG43089)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     Dmel_CG43089 (CG43089)
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     Dmel_CG43089 (CG43089)
SSDB
Motif
Pfam: Skp1_POZ
Other DBs
NCBI-GeneID: 12798588
NCBI-ProteinID: NP_001246606
FlyBase: FBgn0262535
UniProt: M9ND39
LinkDB
Position
3L
AA seq 144 aa
MSSSSSEAIQLQTNDGVIHTVDMRFALQICPVRNMIMQERQKNLHTDDVIPLPRVDAKNL
RFIIKWWTSVQNLDENLLTMGKRKLKQLLTAEHANHQFLLQIILAADYLQMEKFLLISTH
LMADALNECESVEEIRRKFFWNKV
NT seq 435 nt   +upstreamnt  +downstreamnt
atgtcgtcctcttcttcagaagcaattcaacttcagaccaacgatggtgtcattcataca
gtggacatgcgctttgctctacagatatgccccgtgcgcaatatgataatgcaggagaga
cagaaaaatttgcacaccgatgatgttatccctctaccgagagtcgatgccaaaaacctt
cgatttataatcaagtggtggacatctgtgcagaatctagatgaaaatcttctcactatg
ggcaaaagaaaacttaagcagttgctaacggcggaacatgccaaccatcagtttctgctg
caaatcatccttgccgccgactatctgcaaatggagaaatttttgctgatcagcacacat
ctcatggcggatgctttaaatgaatgtgaaagtgtcgaagagatacgtagaaagtttttt
tggaataaagtgtaa

KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8881
Entry
Dmel_CG8881       CDS       T00030                                 

Gene name
SkpB
Definition
(RefSeq) SKP1-related B
  KO
K03094  S-phase kinase-associated protein 1
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04120  Ubiquitin mediated proteolysis
dme04141  Protein processing in endoplasmic reticulum
dme04310  Wnt signaling pathway
dme04341  Hedgehog signaling pathway - fly
dme04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dmel_CG8881 (SkpB)
   04120 Ubiquitin mediated proteolysis
    Dmel_CG8881 (SkpB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG8881 (SkpB)
   04341 Hedgehog signaling pathway - fly
    Dmel_CG8881 (SkpB)
   04350 TGF-beta signaling pathway
    Dmel_CG8881 (SkpB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dme04121]
    Dmel_CG8881 (SkpB)
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG8881 (SkpB)
Ubiquitin system [BR:dme04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     Dmel_CG8881 (SkpB)
   Cul7 complex
     Dmel_CG8881 (SkpB)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     Dmel_CG8881 (SkpB)
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     Dmel_CG8881 (SkpB)
SSDB
Motif
Pfam: Skp1 Skp1_POZ
Other DBs
NCBI-GeneID: 36298
NCBI-ProteinID: NP_610729
FlyBase: FBgn0026176
UniProt: Q7KJ69
LinkDB
Position
2R
AA seq 161 aa
MPIIRLESADKEIFDTDQEIAKCSETIRIAIEDLGDESDNSVLPLPNVNSLILKKVLHWA
TYHKDDPVVTEEVENKEKRTDDISSWDADFLKVDQGTLFELILAANYLNIQGLLDVTCKT
VANMIKGKSPQAIRDTFAIQNDFLPQEEEQVRKENEWCEDK
NT seq 486 nt   +upstreamnt  +downstreamnt
atgcccatcattcggctggagtctgcggacaaggagatctttgacacggatcaggagatc
gccaagtgctcggaaacgattcgcattgcaatagaggatttgggcgatgagagcgacaac
agtgtgctgccgttgccgaatgtcaactcgctgatcctgaagaaagtgctccactgggcc
acctatcacaaggacgatcctgtggttaccgaagaggttgagaacaaggagaagcgcact
gatgacatctcatcctgggacgctgactttctcaaagtcgaccagggcacgctgttcgaa
ctgatcctcgcggcaaactacctgaatatccagggtctgctcgacgtcacctgcaagacg
gtggccaatatgatcaagggcaagtcgccgcaggctattcgcgacaccttcgccatccag
aatgactttctgccacaggaggaggaacaggtgcgcaaggagaacgagtggtgtgaggat
aaatga

DBGET integrated database retrieval system