KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3218
Entry
Dmel_CG3218       CDS       T00030                                 

Gene name
fs(1)K10
Definition
(RefSeq) female sterile (1) K10
  KO
K02524  DNA binding protein (fs(1)K10, female sterile(1)K10)
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04320  Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dme00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04320 Dorso-ventral axis formation
    Dmel_CG3218 (fs(1)K10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dme03019]
    Dmel_CG3218 (fs(1)K10)
Messenger RNA biogenesis [BR:dme03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     Dmel_CG3218 (fs(1)K10)
SSDB
Other DBs
NCBI-GeneID: 47781
NCBI-ProteinID: NP_477491
FlyBase: FBgn0000810
UniProt: P13468
LinkDB
Position
X
AA seq 463 aa
MVSKNQFYQNWTMQSQQQHPHQMQQQFQQQQQPNLQHRNNQSNNNNCNNNPRAAAAPYRK
PFRSGKINSGPGGNGNGNRVNGNNQMMFSSSQMPSDPLYIDFSSPPPGFKHNQVGSPKKK
SMKGIKQQQHPSPNQQQPPSPNQQQHPSPNQQQHPSPNQQQHPNSNQQQHLSPNQQQGKM
NNQNNNHMNQSQQPFNNQMNGSDWQRHPGNNPNQIRGGFNGFQRGPPPNRPPPRLMMGPP
MGPMGPGPRGPGPMGPGGPYPQMPFPPPVPGMRGPGPMGPMGGPPPPPPPLFMRRNGPGP
GPMMGVPPPMHMMGPRMPPRGIPPVGPYGPMNMNGGRIMKPNPKLIKQVVKGKSSIKTLK
NLINQYPIEKPWVTDEIRSEHDKKVDIENRLKGHKDDELFAQYKGQRDKFVSLYEAAREE
YLKQEAATVKAKDAKSDKDKNAISSQSAAPKAGSAKDATIPNP
NT seq 1392 nt   +upstreamnt  +downstreamnt
atggtgtccaagaaccaattctatcagaactggaccatgcagtcgcagcagcagcacccg
caccaaatgcagcaacagtttcagcaacagcagcagccaaatctgcagcaccgcaacaac
cagagcaacaataataattgcaacaataatccccgcgcagctgcggctccgtatagaaaa
ccgtttcgttcgggcaaaattaactccggaccaggaggaaatgggaatggtaacagggtc
aacggtaacaatcagatgatgttttcctccagccaaatgccgagcgatcccctgtacatt
gacttcagcagcccgccaccaggattcaaacacaatcaggtaggcagtcccaagaagaag
tctatgaagggcatcaaacagcagcagcatcccagtccgaaccagcagcagcctcccagt
ccgaaccagcagcagcatcccagtccgaaccagcagcagcatcccagtccgaaccagcag
cagcatcccaattcgaaccagcagcagcatctcagtccgaaccagcagcagggcaagatg
aacaaccagaacaacaatcatatgaaccagtcgcagcagcccttcaacaatcagatgaac
ggaagcgattggcagcgccatccgggcaacaatcccaatcagattcgcggtggctttaat
ggattccaacgcgggccgcctccgaaccgtcctcctccacgcctcatgatgggtccgcca
atgggtccgatgggccccggaccacggggacccggaccgatgggccctggaggaccttac
ccgcaaatgcctttcccgccaccggtgcctggtatgcgcggtcccggacccatgggcccc
atgggtggaccaccaccgccgccgccaccgctctttatgcgtcgcaacggacccggtcca
ggtcctatgatgggtgtcccaccgcccatgcacatgatgggtccacggatgccgccgcgg
ggaattccaccggtcggaccttatggaccaatgaacatgaatggcggccggataatgaag
cccaatcccaagctaatcaagcaggtggtgaaaggcaagagcagcataaagacactaaag
aacctgatcaatcagtatcccatcgaaaagccctgggtaacggacgagatacgcagcgag
cacgacaagaaggtggacatcgagaacagattgaagggccacaaagacgacgagctcttc
gctcagtacaagggccagcgggacaagttcgttagtctctacgaagcggcgcgggaagag
tatctcaagcaggaggcagccactgtcaaggccaaggatgccaagtcagacaaagacaaa
aacgcaatttcaagtcagagcgcagcccctaaggccggaagcgctaaagatgcaacaatt
ccaaatccctag

DBGET integrated database retrieval system