Drosophila melanogaster (fruit fly): Dmel_CG42373 Help Entry Dmel_CG42373      CDS       T00030                                  Symbol Tfb5 Name (RefSeq) transcription factor B5   KO K10845   TFIIH basal transcription factor complex TTD-A subunit Organism dme  Drosophila melanogaster (fruit fly) Pathway dme03022   Basal transcription factors dme03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:dme00001]  09120 Genetic Information Processing   09121 Transcription    03022 Basal transcription factors     Dmel_CG42373 (Tfb5)   09124 Replication and repair    03420 Nucleotide excision repair     Dmel_CG42373 (Tfb5)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:dme03021]     Dmel_CG42373 (Tfb5)    03400 DNA repair and recombination proteins [BR:dme03400]     Dmel_CG42373 (Tfb5) Transcription machinery [BR:dme03021]  Eukaryotic type   RNA polymerase II system    Basal transcription factors     TFIIH      Dmel_CG42373 (Tfb5) DNA repair and recombination proteins [BR:dme03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TFIIH complex      Dmel_CG42373 (Tfb5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tfb5 Motif Other DBs NCBI-GeneID:  7354403 NCBI-ProteinID:  NP_001137791 FlyBase:  FBgn0265968 UniProt:  B7Z018 LinkDB All DBs Position 2L Genome browser AA seq 73 aa AA seqDB search MVNVMKGVLVECDPAMKQFLLHLDEKLALGRKFIIQDLDENHLFISTDIVEVLQARVDDL MDRISFPLHDKDA NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atggtaaatgttatgaaaggagtgctggtggagtgtgatcctgctatgaaacaattcctg ctgcacttggacgaaaaactggctctgggacgcaaattcattatccaggatctggacgag aaccatttgtttatctccacggacattgtggaagttttgcaggcgcgagtggacgacttg atggatcggataagctttccgctgcacgacaaggacgcttag

DBGET integrated database retrieval system