KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4637
Entry
Dmel_CG4637       CDS       T00030                                 

Gene name
hh
Definition
(RefSeq) hedgehog
  KO
K06224  hedgehog
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04341  Hedgehog signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04341 Hedgehog signaling pathway - fly
    Dmel_CG4637 (hh)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dme01002]
    Dmel_CG4637 (hh)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dme00536]
    Dmel_CG4637 (hh)
Peptidases and inhibitors [BR:dme01002]
 Cysteine peptidases
  Family C46: hedgehog family
   Dmel_CG4637 (hh)
Glycosaminoglycan binding proteins [BR:dme00536]
 Heparan sulfate / Heparin
  Morphogens
   Dmel_CG4637 (hh)
SSDB
Motif
Pfam: HH_signal Hint
Other DBs
NCBI-GeneID: 42737
NCBI-ProteinID: NP_001034065
FlyBase: FBgn0004644
UniProt: Q02936
LinkDB
Structure
PDB: 
1AT0 2IBG

Position
3R
AA seq 471 aa
MDNHSSVPWASAASVTCLSLDAKCHSSSSSSSSKSAASSISAIPQEETQTMRHIAHTQRC
LSRLTSLVALLLIVLPMVFSPAHSCGPGRGLGRHRARNLYPLVLKQTIPNLSEYTNSASG
PLEGVIRRDSPKFKDLVPNYNRDILFRDEEGTGADRLMSKRCKEKLNVLAYSVMNEWPGI
RLLVTESWDEDYHHGQESLHYEGRAVTIATSDRDQSKYGMLARLAVEAGFDWVSYVSRRH
IYCSVKSDSSISSHVHGCFTPESTALLESGVRKPLGELSIGDRVLSMTANGQAVYSEVIL
FMDRNLEQMQNFVQLHTDGGAVLTVTPAHLVSVWQPESQKLTFVFADRIEEKNQVLVRDV
ETGELRPQRVVKVGSVRSKGVVAPLTREGTIVVNSVAASCYAVINSQSLAHWGLAPMRLL
STLEAWLPAKEQLHSSPKVVSSAQQQNGIHWYANALYKVKDYVLPQSWRHD
NT seq 1416 nt   +upstreamnt  +downstreamnt
atggataaccacagctcagtgccttgggccagtgccgccagtgtcacctgtctctccctg
gatgccaaatgccacagttccagttccagttccagctccaaatccgcagcgagctccatc
tccgcaatcccgcaagaagaaacgcaaacgatgcgccacattgcgcatacgcagcgttgc
ctcagcaggctgacctctctggtggccctgctgctgatcgtcttgccgatggtctttagc
ccggctcacagctgcggtcctggccgaggattgggtcgtcatagggcgcgcaacctgtat
ccgctggtcctcaagcagacaattcccaatctatccgagtacacgaacagcgcctccgga
cctctggagggtgtgatccgtcgggactcgcccaaattcaaggacctcgtgcccaactac
aacagggacatccttttccgcgacgaggaaggcaccggagcggatcgcttgatgagcaag
cgctgcaaggagaagctaaacgtgctggcctactcggtgatgaacgaatggcccggcatc
cggctgctggtcaccgagagctgggacgaggactaccatcacggccaggagtcgctccac
tacgagggccgagcggtgaccattgccacctccgatcgcgaccagtccaaatacggcatg
ctcgctcgcctggccgtcgaggctggattcgattgggtctcctacgtcagcaggcgccac
atctactgctccgtcaagtcagattcgtcgatcagttcccacgtgcacggctgcttcacg
ccggagagcacagcgctgctggagagtggagtccggaagccgctcggcgagctctctatc
ggagatcgtgttttgagcatgaccgccaacggacaggccgtctacagcgaagtgatcctc
ttcatggaccgcaacctcgagcagatgcaaaactttgtgcagctgcacacggacggtgga
gcagtgctcacggtgacgccggctcacctggttagcgtttggcagccggagagccagaag
ctcacgtttgtgtttgcggatcgcatcgaggagaagaaccaggtgctcgtacgggatgtg
gagacgggcgagctgaggccccagcgagtcgtcaaggtgggcagtgtgcgcagtaagggc
gtggtcgcgccgctgacccgcgagggcaccattgtggtcaactcggtggccgccagttgc
tatgcggtgatcaacagccagtcgctggcccactggggactggctcccatgcgcctgctg
tccacgctggaggcgtggctgcccgccaaggagcagttgcacagttcgccgaaggtggtg
agctcggcgcagcagcagaatggcatccattggtatgccaatgcgctctacaaggtcaag
gactacgttctgccgcagagctggcgccacgattga

DBGET integrated database retrieval system