KEGG   Desulfosporosinus meridiei: Desmer_0447
Entry
Desmer_0447       CDS       T02207                                 
Name
(GenBank) tetrahydromethanopterin S-methyltransferase, subunit H
  KO
K25221  [methyl-Co(III) glycine betaine-specific corrinoid protein]---tetrahydrofolate methyltransferase [EC:2.1.1.378]
Organism
dmi  Desulfosporosinus meridiei
Pathway
dmi00670  One carbon pool by folate
dmi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Desmer_0447
Enzymes [BR:dmi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.378  [methyl-Co(III) glycine betaine-specific corrinoid protein]---tetrahydrofolate methyltransferase
     Desmer_0447
SSDB
Motif
Pfam: MtrH DUF3306
Other DBs
NCBI-ProteinID: AFQ42496
UniProt: J7IUW7
LinkDB
Position
461591..462511
AA seq 306 aa
MLKYDTEQHVYDINGVKVGGQPGQYPTVLIGSIFYRGHKIVQDDKKGIFDEAAAKALLDR
EAELSAETGNPFILDVLGESVEALTKYVEFVMKNSQAPFLLDSISPAVRIGALKELGKDP
EIRKRLIYNSIEEHYSEEELAVIKDSGIKTAVILAFSNKALKPQARIKLLRGDGQKEGLI
DAAKRAGIEQFLVDPGVLDVPSASWTSEAIHVVNQEFGYPGGCAPSNAVYLWKKMRSKGT
PFFEVAGAAVFTYPVTQGASFILYGPMINAPWVYRAMATTDAMMAYNNKLTGVKLGTSEH
PLLKIF
NT seq 921 nt   +upstreamnt  +downstreamnt
atgctcaagtatgatacagaacaacatgtttatgatatcaatggagtgaaagtaggtgga
cagccgggacaatatcctactgtgcttatcggcagtatcttttatcggggacataaaata
gtccaagatgataagaaggggatttttgatgaagcagctgctaaagctctgctggatcga
gaagctgagctgagtgctgaaactggcaatccctttattctggatgtcttaggggaatcc
gtagaagctttaactaaatacgtagaatttgtcatgaaaaattcccaggctccctttttg
ttagacagtatcagtccggcagtgcgaattggtgccttgaaagagctaggcaaggatcct
gaaatccgaaaacgattgatctacaactccattgaggaacattattcggaggaagagtta
gccgtgataaaagatagcggaatcaaaaccgccgtcattttggcctttagtaataaagct
ttaaagccccaagccagaattaagcttttgaggggggatgggcaaaaagaaggtttaatt
gatgccgctaagagagcaggaattgagcagtttttggttgatcctggtgtattggacgtt
cctagtgccagctggacaagtgaggctattcatgtggttaatcaagaatttggttatccc
ggaggatgcgccccttctaacgcagtttatttgtggaaaaagatgcgatccaaaggaact
ccgtttttcgaagtagccggggctgccgtctttacctatccagtaactcagggtgccagc
ttcattctctacggccccatgatcaacgcaccttgggtgtatagggccatggcaaccaca
gatgcgatgatggcctataataataagctgaccggagttaagctggggacgtccgagcat
ccattattgaagatcttttag

DBGET integrated database retrieval system