KEGG   Dasypus novemcinctus (nine-banded armadillo): 101430817
Entry
101430817         CDS       T07872                                 
Symbol
NRAS
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
dnm  Dasypus novemcinctus (nine-banded armadillo)
Pathway
dnm01521  EGFR tyrosine kinase inhibitor resistance
dnm01522  Endocrine resistance
dnm04010  MAPK signaling pathway
dnm04012  ErbB signaling pathway
dnm04014  Ras signaling pathway
dnm04015  Rap1 signaling pathway
dnm04062  Chemokine signaling pathway
dnm04068  FoxO signaling pathway
dnm04071  Sphingolipid signaling pathway
dnm04072  Phospholipase D signaling pathway
dnm04137  Mitophagy - animal
dnm04140  Autophagy - animal
dnm04150  mTOR signaling pathway
dnm04151  PI3K-Akt signaling pathway
dnm04210  Apoptosis
dnm04211  Longevity regulating pathway
dnm04213  Longevity regulating pathway - multiple species
dnm04218  Cellular senescence
dnm04360  Axon guidance
dnm04370  VEGF signaling pathway
dnm04371  Apelin signaling pathway
dnm04540  Gap junction
dnm04550  Signaling pathways regulating pluripotency of stem cells
dnm04625  C-type lectin receptor signaling pathway
dnm04650  Natural killer cell mediated cytotoxicity
dnm04660  T cell receptor signaling pathway
dnm04662  B cell receptor signaling pathway
dnm04664  Fc epsilon RI signaling pathway
dnm04714  Thermogenesis
dnm04720  Long-term potentiation
dnm04722  Neurotrophin signaling pathway
dnm04725  Cholinergic synapse
dnm04726  Serotonergic synapse
dnm04730  Long-term depression
dnm04810  Regulation of actin cytoskeleton
dnm04910  Insulin signaling pathway
dnm04912  GnRH signaling pathway
dnm04915  Estrogen signaling pathway
dnm04916  Melanogenesis
dnm04917  Prolactin signaling pathway
dnm04919  Thyroid hormone signaling pathway
dnm04921  Oxytocin signaling pathway
dnm04926  Relaxin signaling pathway
dnm04929  GnRH secretion
dnm04933  AGE-RAGE signaling pathway in diabetic complications
dnm04935  Growth hormone synthesis, secretion and action
dnm05010  Alzheimer disease
dnm05022  Pathways of neurodegeneration - multiple diseases
dnm05034  Alcoholism
dnm05160  Hepatitis C
dnm05161  Hepatitis B
dnm05163  Human cytomegalovirus infection
dnm05165  Human papillomavirus infection
dnm05166  Human T-cell leukemia virus 1 infection
dnm05167  Kaposi sarcoma-associated herpesvirus infection
dnm05170  Human immunodeficiency virus 1 infection
dnm05200  Pathways in cancer
dnm05203  Viral carcinogenesis
dnm05205  Proteoglycans in cancer
dnm05206  MicroRNAs in cancer
dnm05207  Chemical carcinogenesis - receptor activation
dnm05208  Chemical carcinogenesis - reactive oxygen species
dnm05210  Colorectal cancer
dnm05211  Renal cell carcinoma
dnm05213  Endometrial cancer
dnm05214  Glioma
dnm05215  Prostate cancer
dnm05216  Thyroid cancer
dnm05218  Melanoma
dnm05219  Bladder cancer
dnm05220  Chronic myeloid leukemia
dnm05221  Acute myeloid leukemia
dnm05223  Non-small cell lung cancer
dnm05224  Breast cancer
dnm05225  Hepatocellular carcinoma
dnm05226  Gastric cancer
dnm05230  Central carbon metabolism in cancer
dnm05231  Choline metabolism in cancer
dnm05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dnm05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dnm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101430817 (NRAS)
   04012 ErbB signaling pathway
    101430817 (NRAS)
   04014 Ras signaling pathway
    101430817 (NRAS)
   04015 Rap1 signaling pathway
    101430817 (NRAS)
   04370 VEGF signaling pathway
    101430817 (NRAS)
   04371 Apelin signaling pathway
    101430817 (NRAS)
   04068 FoxO signaling pathway
    101430817 (NRAS)
   04072 Phospholipase D signaling pathway
    101430817 (NRAS)
   04071 Sphingolipid signaling pathway
    101430817 (NRAS)
   04151 PI3K-Akt signaling pathway
    101430817 (NRAS)
   04150 mTOR signaling pathway
    101430817 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101430817 (NRAS)
   04137 Mitophagy - animal
    101430817 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    101430817 (NRAS)
   04218 Cellular senescence
    101430817 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101430817 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    101430817 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101430817 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101430817 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    101430817 (NRAS)
   04660 T cell receptor signaling pathway
    101430817 (NRAS)
   04662 B cell receptor signaling pathway
    101430817 (NRAS)
   04664 Fc epsilon RI signaling pathway
    101430817 (NRAS)
   04062 Chemokine signaling pathway
    101430817 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101430817 (NRAS)
   04929 GnRH secretion
    101430817 (NRAS)
   04912 GnRH signaling pathway
    101430817 (NRAS)
   04915 Estrogen signaling pathway
    101430817 (NRAS)
   04917 Prolactin signaling pathway
    101430817 (NRAS)
   04921 Oxytocin signaling pathway
    101430817 (NRAS)
   04926 Relaxin signaling pathway
    101430817 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    101430817 (NRAS)
   04919 Thyroid hormone signaling pathway
    101430817 (NRAS)
   04916 Melanogenesis
    101430817 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    101430817 (NRAS)
   04726 Serotonergic synapse
    101430817 (NRAS)
   04720 Long-term potentiation
    101430817 (NRAS)
   04730 Long-term depression
    101430817 (NRAS)
   04722 Neurotrophin signaling pathway
    101430817 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    101430817 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    101430817 (NRAS)
   04213 Longevity regulating pathway - multiple species
    101430817 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    101430817 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101430817 (NRAS)
   05206 MicroRNAs in cancer
    101430817 (NRAS)
   05205 Proteoglycans in cancer
    101430817 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    101430817 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    101430817 (NRAS)
   05203 Viral carcinogenesis
    101430817 (NRAS)
   05230 Central carbon metabolism in cancer
    101430817 (NRAS)
   05231 Choline metabolism in cancer
    101430817 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101430817 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101430817 (NRAS)
   05225 Hepatocellular carcinoma
    101430817 (NRAS)
   05226 Gastric cancer
    101430817 (NRAS)
   05214 Glioma
    101430817 (NRAS)
   05216 Thyroid cancer
    101430817 (NRAS)
   05221 Acute myeloid leukemia
    101430817 (NRAS)
   05220 Chronic myeloid leukemia
    101430817 (NRAS)
   05218 Melanoma
    101430817 (NRAS)
   05211 Renal cell carcinoma
    101430817 (NRAS)
   05219 Bladder cancer
    101430817 (NRAS)
   05215 Prostate cancer
    101430817 (NRAS)
   05213 Endometrial cancer
    101430817 (NRAS)
   05224 Breast cancer
    101430817 (NRAS)
   05223 Non-small cell lung cancer
    101430817 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101430817 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    101430817 (NRAS)
   05161 Hepatitis B
    101430817 (NRAS)
   05160 Hepatitis C
    101430817 (NRAS)
   05163 Human cytomegalovirus infection
    101430817 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101430817 (NRAS)
   05165 Human papillomavirus infection
    101430817 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101430817 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    101430817 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    101430817 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101430817 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101430817 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101430817 (NRAS)
   01522 Endocrine resistance
    101430817 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dnm04131]
    101430817 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dnm04147]
    101430817 (NRAS)
   04031 GTP-binding proteins [BR:dnm04031]
    101430817 (NRAS)
Membrane trafficking [BR:dnm04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    101430817 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    101430817 (NRAS)
Exosome [BR:dnm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101430817 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   101430817 (NRAS)
  Exosomal proteins of breast cancer cells
   101430817 (NRAS)
  Exosomal proteins of colorectal cancer cells
   101430817 (NRAS)
GTP-binding proteins [BR:dnm04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    101430817 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Septin Ldh_1_N ParA
Other DBs
NCBI-GeneID: 101430817
NCBI-ProteinID: XP_004485125
LinkDB
Position
Unknown
AA seq 174 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLGKRNTSVPNEKTQQQ
NT seq 525 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca
atccagctaatccagaaccactttgtagatgagtatgatcccaccatagaggattcttac
cgaaaacaggtggttatagatggtgaaacctgtctgctggacatactggatacagccgga
caagaggagtacagtgccatgagagaccagtacatgaggacaggcgaaggtttcctctgt
gtgtttgccatcaataatagcaaatcatttgcagatattaacctctacagagagcagatt
aaacgagttaaagactcagatgatgtacctatggtgctggtaggaaacaagtgtgatttg
ccaacaaggacagttgacacaaaacaagcccatgaactggccaagagttatgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaagatgcgttttacacactgggt
aagagaaatacgtcagtaccgaatgaaaaaactcaacagcaatga

DBGET integrated database retrieval system