Dichelobacter nodosus: DNO_0595 Help Entry DNO_0595          CDS       T00517                                  Symbol hfq Name (GenBank) Hfq RNA-binding protein   KO K03666   host factor-I protein Organism dno  Dichelobacter nodosus Pathway dno02024   Quorum sensing dno03018   RNA degradation Brite KEGG Orthology (KO) [BR:dno00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     DNO_0595 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     DNO_0595 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:dno03019]     DNO_0595 (hfq)    03036 Chromosome and associated proteins [BR:dno03036]     DNO_0595 (hfq) Messenger RNA biogenesis [BR:dno03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      DNO_0595 (hfq) Chromosome and associated proteins [BR:dno03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     DNO_0595 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  ABQ13131 UniProt:  A5EVF4 LinkDB All DBs Position 631250..631570 Genome browser AA seq 106 aa AA seqDB search MSKSQSLQDPYLNALRKERVPVSIYLVNGIKLQGQIESFDAFVILLRNNISQMVYKHAVS TIVPSRNIHLSREEMGLEDEAGEEISAEYTPNAEGQAEATADPLYD NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgagtaagtcacaatctcttcaagacccgtacctaaatgctttgcgtaaagaacgcgtg ccggtatcgatctatttggtaaatggaattaaattgcaggggcaaatagagtcttttgat gcttttgttattttgctacgcaataatatttcacaaatggtatataaacatgcagtgtca accattgttccctctcgtaatattcatttaagtcgggaagaaatgggattggaagatgaa gccggcgaggaaatcagcgccgaatatactccaaacgcagaaggacaagcggaagcaacc gccgatccgttatacgattaa

DBGET integrated database retrieval system