KEGG   Drosophila navojoa: 115565119
Entry
115565119         CDS       T05898                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
dnv  Drosophila navojoa
Pathway
dnv00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:dnv00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    115565119
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:dnv00199]
    115565119
Enzymes [BR:dnv01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     115565119
Cytochrome P450 [BR:dnv00199]
 Cytochrome P450, animal type
  CYP306 family
   115565119
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 115565119
NCBI-ProteinID: XP_030245978
LinkDB
Position
Unknown
AA seq 504 aa
MSADELGLAVFGVLLSLVCIIVALICQRRNARLLGRTPPGPWGVPLLGYLPFVDRLAPHK
SLQALAGRYGAIYQLSMGSVRTVVLADAALVRDFLRHEELTARAPLYLTHGIMGGYGIIG
AGGDIWKYQRRQLIEWLKALGMTRKQCETRAQLEQRISSGVNECVQAYESEAKAPLDPLP
ALQHTLGNIINDLVFGETYERRDPNWLYLQQLQEQGVKLIGVSGMVNFLPWLRHLPGNKR
SIRFLLDGKAKTHALYDRIIERCAQQLQQQQSPRRSILAHFLHERQPYSQLYCDEQLRHL
LADLFGAGVDTSLATLRWFLLYMAREQRCQQRLQSELRNLSESPTLAELEPIAYLRACLS
ETQRVRSVVPLGIPHGVDQDTMVGDYHLRKGTMVLVLQWAIHMNPEAWPEPEQFRPERFL
NADGDYVAPAQFIPFQTGKRMCPGDELARMMLTLYAGRILRRFHVQLPAGEAQHVDFEGE
CGITLAPAPYKLQFTPMEELPKNE
NT seq 1515 nt   +upstreamnt  +downstreamnt
atgagtgcagacgaactgggcctggccgtcttcggggtgctgctgtcgctcgtctgcatc
atagttgcgctgatctgccagcggcgcaatgcgcgtctgctgggtcgcacgccgcccggg
ccgtggggcgtgccgctgctgggctacttgccgttcgtggatcgcctggcgccgcacaag
tcgctgcaggcgctggccggccgctacggcgccatctatcagctgagcatgggcagcgtg
cggacggtggtgctggcggatgcggcgctggtgcgtgactttctgcggcacgaggagctg
accgcccgggcgccgctctacctgacgcacggcatcatgggcggctatggcatcattggc
gccggcggcgacatatggaaatatcagcgcaggcagctgatcgagtggctcaaggcgctg
ggcatgacgcgcaagcagtgcgagacgcgtgcgcagctggagcagcgcatcagcagcggc
gtcaacgagtgcgtccaggcctacgagtcggaggcgaaggccccactggacccgctgccg
gcgctgcagcacacgctgggcaacatcatcaacgatctggtctttggcgagacctacgag
cgccgcgaccccaactggctgtacctgcagcagctgcaggagcagggcgtcaagctgatc
ggcgtctcgggcatggtcaactttttgccctggctgcgccatctgccgggcaacaagcgc
agcatacgtttcctgctggacggcaaggccaagacgcatgcgctctacgatcgcatcatc
gaacgctgcgcgcagcagctgcagcagcagcagtcgcctaggcgcagcatcttggcacac
ttcctgcacgagcgtcagccctactcgcagctctattgcgatgagcaactgcgtcacctg
ctggccgatctcttcggcgccggcgtggatacgtcgctggcaacgctgcgctggttcctg
ctctacatggcgcgcgagcagcgctgccagcagcgactgcagtcggagctgcgcaacctc
agcgagtcgcccacgctggccgagctcgagcccattgcctatctgcgcgcctgcctctcg
gagacgcagcgagttcggtccgtggtgccgctgggcataccgcacggcgtcgaccaggac
accatggtgggtgactaccacctgaggaagggcaccatggtgctggtgctgcagtgggcc
atacatatgaatcccgaggcctggccggagccggagcagttccggccggagcgtttcctc
aacgccgacggcgactatgtggcgcccgctcagttcatacccttccagacgggcaagcgc
atgtgtcccggcgatgagctggcccgcatgatgctcacgctctatgcgggccgtattctg
cgtcgctttcacgtgcagctgcccgccggagaggcgcaacacgtggacttcgagggcgaa
tgcggcatcaccttggctccggcgccctacaaacttcaatttacccccatggaagagcta
cccaagaacgaataa

DBGET integrated database retrieval system