Dipodomys ordii (Ord's kangaroo rat): 105981630 Help Entry 105981630         CDS       T07834                                  Symbol Ghrh Name (RefSeq) somatoliberin   KO K05260   growth hormone-releasing hormone Organism dord  Dipodomys ordii (Ord's kangaroo rat) Pathway dord04080   Neuroactive ligand-receptor interaction dord04081   Hormone signaling dord04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:dord00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     105981630 (Ghrh)    04081 Hormone signaling     105981630 (Ghrh)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     105981630 (Ghrh)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dord04052]     105981630 (Ghrh) Cytokines and neuropeptides [BR:dord04052]  Neuropeptides   GPCR binding    105981630 (Ghrh) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_2 Motif Other DBs NCBI-GeneID:  105981630 NCBI-ProteinID:  XP_012866299 Ensembl:  ENSDORG00000009170 UniProt:  A0A1S3EQU8 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MPLWVFFIVILALSSSSHCLPPPSLPLRMRRYADAIFSNSYRKVLGQLSARKLLQDLMNR QQAEKNQGQGAKLRPGRQLDHMWADQEQMALESILAALLQKSSRNYHG NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgccactgtgggtgttctttatcgtgatcctggccctcagcagcagctcccactgcttg ccgcccccctccctgcccctcaggatgcggcgctatgcagatgccatcttcagcaacagc taccggaaggtgctgggccagctgtctgcccggaagttgctccaggacctcatgaacagg cagcaagcagagaagaaccaggggcaaggagcaaagctgcggccaggccggcagctggac cacatgtgggcagaccaagaacagatggcattggagagcatcctggcagccctactgcaa aagagcagcaggaattaccatggatga

DBGET integrated database retrieval system