KEGG   Dendroctonus ponderosae (mountain pine beetle): 109543068
Entry
109543068         CDS       T04899                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
Pathway
dpa00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:dpa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    109543068
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:dpa00199]
    109543068
Enzymes [BR:dpa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     109543068
Cytochrome P450 [BR:dpa00199]
 Cytochrome P450, animal type
  CYP306 family
   109543068
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 109543068
NCBI-ProteinID: XP_019768148
LinkDB
Position
Unknown
AA seq 491 aa
MIFYVLLLLLALLALLGRPRGLPPGPWGLPLLGYLPWIDPKAPHLTLARLARKFGPIYSL
TLGRVCAIVLTDPRTIRRLLAKDATSGRAPLYVTHGIMHGYGLICAEGALWRDQRKFVHN
WLRSAGGTKLGGRRKLMELLILQHAQELVQHIDAALKRHAVDPMEALRHHLGSLVNQLVF
GRRYQRDDPTWIWLQELQEEGCKLIGVAGPLNFLPLLRFLPTYKRTMSFLVEGQRKSHQY
YQKLAKEVEPLVPLDRNQSLDALPSLLEEFLREKRLKSGTEDGHRFYSDRQMDHLLADIF
GASLDTTLTTLRWFLLFLGVNQDVQRELRLEIEAVVGKRAPSLEDLAAMPFLEACIAETQ
RIRSVVPLGVPHGALEDLEVDGYRIPKGSLILLLQWAIHMDEAQHRDPERFNPRRFLDAE
GRFCKGEFFMPFQTGKRMCVGDELAKEIMFLFTASLFQSFRVQVVGEPELEGVCGITLSP
QPYQVVFQSLA
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgatattctacgtgctgctgcttctgctggcgctgctggcccttctagggcggccccgc
gggttgccgcccggtccctggggtctacccctgctcggctacctgccctggatcgaccct
aaggcgccccacttgacgcttgcgcgactggcgcgcaagttcggccccatctacagcctg
accctagggcgagtgtgcgcgatcgttttgaccgacccccgtaccatcaggaggctgctg
gcgaaagatgccaccagtggtcgcgcccccctgtatgttacccatggaattatgcatgga
tatggtttgatttgcgccgaaggcgccctgtggagggatcagcgcaaattcgtccacaac
tggctcagatcggctggcggcaccaagctgggcggccggcgcaagctgatggagcttctg
atcctgcagcatgctcaggagctggtgcagcacatcgacgcggcgctgaagcgccacgca
gttgatccgatggaggcgctgcgccaccacttgggttcgctggtgaaccagctggtgttt
gggcggaggtaccagagggacgacccaacgtggatctggctgcaggagctgcaggaggag
ggctgcaagctgattggggtggccggaccgctcaacttcctcccactcctcagatttctg
cccacctacaagcgaacgatgtccttcctggtggaaggccagcgcaagtcgcaccaatac
taccaaaagctggccaaagaagtggaacctttggttccactggacaggaaccagagcctg
gacgccctccccagcctcctggaggagttcctcagggaaaagcgcctcaaatcgggcaca
gaggacggccatcgcttctacagcgaccgccagatggaccatctgctggccgatatcttc
ggcgcttcgctcgacaccactttgaccactttgaggtggttcctactgttcctgggggtc
aaccaggacgtccagcgggagctccgattggagattgaggcggtggtggggaagcgagcg
ccctcattggaggacctggcagcgatgccgtttctggaggcctgcattgcggagacgcag
cgcatccgctcggtggttcctctgggcgtgccgcatggagcgctggaggacctggaggtc
gatgggtaccgcatccctaagggttccctcatcctcctgctgcaatgggccatccacatg
gatgaggcgcagcatcgcgatccagagaggttcaacccacgccgctttctggatgccgaa
ggccgcttttgcaagggggagttcttcatgcccttccagactgggaagcggatgtgtgtg
ggggacgagctggccaaggagataatgttcctgttcactgccagccttttccagagcttc
cgggtgcaggtggtgggcgagccggagctggagggcgtctgtgggatcaccctgagtccc
cagccctaccaggtggtcttccagagccttgcctag

DBGET integrated database retrieval system