KEGG   Drosophila persimilis: 6601726
Entry
6601726           CDS       T01063                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
dpe  Drosophila persimilis
Pathway
dpe00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    6601726
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:dpe00199]
    6601726
Enzymes [BR:dpe01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     6601726
Cytochrome P450 [BR:dpe00199]
 Cytochrome P450, animal type
  CYP306 family
   6601726
SSDB
Motif
Pfam: p450 Tra1_central eIF3h_C CDC45
Other DBs
NCBI-GeneID: 6601726
NCBI-ProteinID: XP_026847008
LinkDB
Position
Unknown
AA seq 575 aa
MSASFATASASVFDWLPLSGHSFCLLVVPGLLILIILWLCDHQYDRVLGRPPPGPWGLPW
LGYLLFLSRRAPHKSLQALARRYGGIYQLRMGSVKAVILSDVTLVREFFRHEVMAARAPL
YLTHGIMGGYGIICAAGPIWKHQRRELIDWLKALGMTRRPGETRSRLEQRIGRGVDECVQ
LYETDADVSPSSEFDPVPALQHTLGNIINDLVFGVTYERQDPDWLYLQRLQEEGVKLIGV
SGVVNFLPWLRSLPWNRRNICFLMEGKSRTHAIYDRIVESCENKLKELQEQYQEKQRQRQ
QQQDLQQYQQQNPQQDPEQEDQKGEEEDDDDDDDDVYEPTCILEHFLINRVPFSELYCDE
QLRHLLADLFGAGVDTSLATLRWFLLYMAREQSSQRRLHELLLPLSATPTLEELQPLAFL
RACISEVQRIRSVVPLGIPHGAERDFTVGKYRIAAGSMIVSLQWAIHMDPAVWPEPEQFR
PDRFLNAEGHYSAPPQFIPFQTGKRMCPGDELARMMLTLFAGRILRRFHVEMVPGCDADM
EGECGITLAPAPYKLRFTKLPPMELQVEEQPLVQA
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgtcggcgtccttcgccaccgcctccgcctccgtcttcgactggctgcccctgtcggga
cacagtttttgcctgctggtggtgcccgggctgcttatcctgatcatcctctggctgtgc
gaccaccagtacgacagagtactaggacgtccgcccccagggccctggggtctgccgtgg
ctgggctacctgctcttcctaagccgccgggcaccccacaaatcgctgcaggctttggcc
cgccgctacgggggcatctatcaactgcgcatgggcagcgtaaaggcagtgatactctcg
gacgtgaccctggtccgggagttcttccgccacgaggtgatggcggctcgggcgccgctc
tacctcacacacggcatcatgggcggatatggcatcatctgcgccgcgggtcccatttgg
aaacatcagcgtcgagagcttatcgattggctgaaggcattggggatgacgcggcgaccg
ggagagacgcggagccgtctcgagcagcggatcgggaggggtgtggacgagtgtgtgcag
ctgtacgaaacggatgcggatgtgagtccttcgtcggagttcgacccggtgcccgccctc
cagcacacgcttgggaatatcatcaacgatctggtcttcggtgtcacctacgagcggcag
gaccccgattggctgtacctgcaacgactgcaggaggagggggtcaaactgatcggcgtc
tcgggcgtggtcaacttcctgccctggctgcgaagcctgccgtggaatcggcgcaacata
tgcttcttgatggaaggcaagtccaggacgcacgccatctacgaccgcatcgtcgagagt
tgcgagaataagcttaaagagctgcaagagcaatatcaggagaagcagcgccagcgccaa
cagcagcaggatctacagcagtaccaacagcagaacccacagcaggatccagagcaagag
gatcagaagggggaggaggaggacgacgacgacgacgacgacgacgtgtatgaacctact
tgtatcctggagcattttcttatcaaccgagtgcccttttcggagctatactgcgacgag
cagctgcgccatctcctcgccgacctcttcggcgccggtgtggacacctccctcgccacg
ctccgctggttcctgctctacatggcccgcgagcagagctcccagcgccgtctgcacgag
ctactccttcccctaagtgccacgcccacactggaggagctgcagccgctggccttcctc
cgggcctgtatctcggaggtgcagcgtatacgcagcgtggtgccgctaggcattccgcac
ggagccgagcgggacttcactgtgggaaagtaccgaatcgcggccggcagcatgatcgtc
tcacttcagtgggccattcacatggacccggcggtgtggccggagccggagcagttccgt
ccggatcgctttctcaatgccgaaggacactactcggcgccgccccagtttatccccttc
cagacgggcaagcgcatgtgtcctggcgatgagctggcccgcatgatgctaacccttttc
gctggtcgcatcctgagacgctttcacgtggagatggtccccggctgcgatgcggacatg
gaaggcgagtgcggcatcaccttggcacccgccccctacaagctgcgcttcacgaagctt
ccgcccatggaattgcaagtggaggagcagccactggtacaggcctag

DBGET integrated database retrieval system