KEGG   Desmodus rotundus (common vampire bat): 112302823
Entry
112302823         CDS       T05907                                 

Gene name
IL33
Definition
(RefSeq) interleukin-33
  KO
K12967  interleukin 33
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04060  Cytokine-cytokine receptor interaction
dro04217  Necroptosis
dro04623  Cytosolic DNA-sensing pathway
dro05164  Influenza A
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112302823 (IL33)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    112302823 (IL33)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    112302823 (IL33)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    112302823 (IL33)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dro04052]
    112302823 (IL33)
Cytokines and growth factors [BR:dro04052]
 Cytokines
  Interleukins
   112302823 (IL33)
SSDB
Motif
Pfam: IL33 AbfB IL1
Other DBs
NCBI-GeneID: 112302823
NCBI-ProteinID: XP_024414096
LinkDB
Position
Unknown
AA seq 260 aa
MKHSTTRISPAKVNNLAGKALVKSPRLRKSQQKVEDVCQMYFMKLRSGNIIENRACYFRK
KTIKGHPPKTARKYEPQLVFSPCQQPCERSSENLAFDVQQRNRRSASEDSFSLSTYNDQS
VTFAFADGGYEIYVEDLGKKQEKDKVLFRYHDSQPPRSPRDDVVDGERLMVSLSPSKDKD
FLLHANNQEHSVELQKCENPLPDQTFFFLHTEPGSSSCVSFECKSNPGVFIGVKDNHLAL
IQLKDKTEHSRRENIKFKLS
NT seq 783 nt   +upstreamnt  +downstreamnt
atgaagcattcaaccaccagaatttccccagcaaaggtgaacaacttagcaggaaaagcc
ctggtaaaatctcccaggttgagaaaatcccaacagaaggtcgaagatgtttgccagatg
tactttatgaagctacgctctggcaatatcatagaaaacagggcctgttactttaggaaa
aaaaccatcaaagggcatccaccaaaaacagctagaaagtacgaaccacaactggtattc
agtccctgtcagcagccctgtgaaaggtcttcagagaaccttgcctttgatgtacagcaa
cgtaacagaagaagtgcttcagaggattctttttccctgagcacctacaatgatcaatct
gttacttttgcttttgcggatggaggttatgagatctatgttgaagatcttggaaaaaaa
caagaaaaagacaaggtgttattccgttaccatgactcacaaccacctagaagtccaaga
gatgatgttgttgatggtgagagattaatggtaagcctgagtccttcaaaagacaaagac
ttcttgctgcatgccaacaaccaggagcattctgtggagctacaaaaatgtgaaaatcca
ttgccagaccagaccttctttttccttcacacggagcccgggtcctcttcatgtgtttca
tttgaatgtaagagcaatcctggagtgtttataggtgtaaaggataatcaccttgctcta
attcaattaaaggacaaaactgagcattcaagaagagagaatatcaaatttaagctctct
taa

DBGET integrated database retrieval system