Desmodus rotundus (common vampire bat): 112304238 Help Entry 112304238         CDS       T05907                                  Symbol GHRH Name (RefSeq) somatoliberin   KO K05260   growth hormone-releasing hormone Organism dro  Desmodus rotundus (common vampire bat) Pathway dro04080   Neuroactive ligand-receptor interaction dro04081   Hormone signaling dro04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:dro00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     112304238 (GHRH)    04081 Hormone signaling     112304238 (GHRH)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     112304238 (GHRH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dro04052]     112304238 (GHRH) Cytokines and neuropeptides [BR:dro04052]  Neuropeptides   GPCR binding    112304238 (GHRH) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_2 YtzH Motif Other DBs NCBI-GeneID:  112304238 NCBI-ProteinID:  XP_024415661 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MLLWVFFLVILTFSSGSHCSSTSPTLRMPRYADAIFTNSYRKVLSQLSARKLLQDIMSRQ QGERTQEQGAKARLGRQVDSMWEDQKQVALESILVALPRKHSRNSQG NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgctgctctgggtgttcttcctcgtgatcctaaccttcagcagcggctcccactgctcc tcgacctccccaaccctcaggatgccgcggtatgccgatgccatcttcaccaacagctac cggaaggtgctgagccagctgtccgcccgcaagctgctccaggacatcatgagcaggcag cagggagagagaacccaggagcaaggagcaaaggcacggctgggccgtcaggtggacagc atgtgggaagaccaaaagcaggtggcattggagagcatcctggtggccctgccgaggaag cacagcaggaattcccaaggatga

DBGET integrated database retrieval system