KEGG   Desmodus rotundus (common vampire bat): 112304778
Entry
112304778         CDS       T05907                                 
Symbol
ITGAX
Name
(RefSeq) integrin alpha-X
  KO
K06462  integrin alpha X
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04610  Complement and coagulation cascades
dro04810  Regulation of actin cytoskeleton
dro05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112304778 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    112304778 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    112304778 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:dro04515]
    112304778 (ITGAX)
   04090 CD molecules [BR:dro04090]
    112304778 (ITGAX)
Cell adhesion molecules [BR:dro04515]
 Integrins
  Integrin alpha subunits
   112304778 (ITGAX)
CD molecules [BR:dro04090]
 Proteins
  112304778 (ITGAX)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_3 VWA_CoxE Integrin_alpha FG-GAP_2
Other DBs
NCBI-GeneID: 112304778
NCBI-ProteinID: XP_024416198
LinkDB
Position
Unknown
AA seq 1160 aa
MTRTRTSLLLSMALASSLCFNLDTDKPTTFLMDSAGFGHSVVQYANSWVVVGAPQEIKAV
NQTGGLYQCAYSTATCGPIDLQVPPEAVNMSLGLSLTAATNPSQLLACGPTVHHACKENM
YLTGFCFLLASPSWKAQRLPAGLQECPRQEQDIVFLIDGSGSISSRNFVKMLSFVKAVMS
QFQRPSAQFSLVQFSDKFKVHFTFKDFIYISDPLSLLDSVRQLEGFTHTATAIRIVIDQL
FSATSGARKDASKILIVITDGRKEGDRLSYQDVIPMAEAAGIIRYAVGVGSAFQNKHSWK
ELNDIASRPSNEYIFKVENFDALRDIQNKLKEKIFAIEGTQTISSSTFELEMSQEGFSAV
FTPDGPVLGAVGSFSWSGGAFVYSPNGSPTFINMSQENVDMRDSYLGYSTELALWKGVKS
LVLGAPRHQHTGKVVIFTQVSRKWRPKAEVTGTQIGSYFGASLCSVDVDRDGSSDLVLIG
APHYFEPTRGGQVSVCPLPQGRARWQCEVILRGEQGHPWGRFGTALTMLGDVNGDKLTDV
AIGAPGEQENQGAVYLFHGTSGLGISLSHSQRITGSQFSPRLQHFGQSLSGGQDLTLDGL
VDLAVGAQGHALLLRTRPVLRVWVNIHVTPAEIARSVYECKEHTSSGQELGDANVCLRIY
GSPKNRLGDLQSSVTFDLTLDPGRLNPRAIFKETSSRSLTRVRVLGLGRHCEDVKLLLPT
CVEDSVTPLTLRLNFSLVGNPISAFGNLQPMLAMDAPRYYTASLPFEKNCGVDHVCQDDL
GISFGFSGMKTLVVGSNLELNMEVKVWNDGEDSYGTTVTFSYPTGLSYRRVAGSQSQLQS
RSLHLTCDSAPARGQDSWSTRCSIKHLIFREGAQITFVATFDVSPKAMLGDRLLLMANVS
SENNTPRTSKTTFQLELPVKYAVYAVISSHEQSTKYLNFSASEEKGSSLAQHRYQVNNLG
QRDLPVSISFLVPVELNQVTVWTGLKILHPQNPSIQCSAERMVPTESNFLTHIQKNRVLD
CSIADCLRFRCDIPSFGVQEELDFILKGNLSFSWVSQTLQKKVSVVSVAEITFDRSVYSQ
LPGQEAFLRAQMKMVLEKHEVHNPILLIVGSSVGGLLLLALLTALLYKVGFFRRQYKEMM
DEASGQAAPENGTSDAQGGQ
NT seq 3483 nt   +upstreamnt  +downstreamnt
atgaccaggaccaggacatcccttcttctgtcgatggcactggcttcctctctctgcttc
aacttggacacagacaagccaacaaccttcctcatggacagtgctgggtttggacacagt
gtggtccagtatgccaactcctgggtggtggttggagccccccaggaaataaaggctgtc
aaccaaacaggaggcctctaccagtgtgcctatagcacagccacctgtgggcccatcgac
ctgcaggtccccccagaagctgtgaacatgtccctgggcctatccctgactgctgccact
aacccttctcagctgctggcctgcggccctactgtgcaccatgcgtgcaaggagaacatg
tacttgaccgggttctgctttctgttggcctccccttcctggaaggcccagaggctccca
gctggtctgcaggagtgcccaaggcaggagcaggacatcgtctttctgatcgacggctca
ggcagcatttcttccagaaattttgtgaagatgctgagcttcgtgaaggctgtgatgagc
cagttccagagacccagcgcccagttctccctggtacagttctccgacaagttcaaggtt
cacttcactttcaaagacttcatatacatctcagacccactaagcctgctggattctgtg
cgtcagctggaggggttcacacacactgccacagccatcaggatcgtcatagaccaacta
ttcagtgccacaagtggggcccgaaaagatgcctccaaaatcctcattgtcatcactgat
gggcggaaagaaggcgaccgcctgagttatcaggatgtcatccctatggctgaggcagca
ggcatcattcgctatgcagttggggtgggatccgcgtttcaaaacaaacattcctggaaa
gaattaaacgacattgcatcaaggccctccaatgaatatatatttaaagtggagaacttt
gatgctttgagagacattcaaaacaaactaaaagagaagatctttgccattgagggtaca
cagacaataagcagtagtaccttcgaattggagatgtcccaggagggcttcagtgctgtg
tttacacccgatggaccagttctgggggctgtggggagcttcagctggtctggaggtgcc
tttgtgtactccccaaatgggagtcccacgttcatcaacatgtctcaggagaatgtggac
atgagggactcctacctgggttactccactgagctggcgctttggaagggggtgaagagc
ttggtcctgggggccccccgccatcagcacaccgggaaggttgtcatctttacccaggtg
tccaggaaatggaggccgaaggctgaagtcacaggaacccagattggctcctactttggg
gcctccctctgctccgtggacgtggacagagatggcagctccgacctggtcctcatcggg
gctccccattacttcgagcccacccgggggggccaggtgtctgtgtgccccttgccccag
gggagagctaggtggcagtgtgaggtcattctccgtggggagcagggccacccctgggga
cgcttcgggacagccctgaccatgctgggggacgtgaatggggacaagctcacggatgtg
gccatcggggccccgggagaacaggagaaccagggtgctgtctacctgtttcatgggacc
tcaggactgggcatcagcctgtcccacagccagaggatcacaggatcccagttctccccc
agactccagcattttggacagtcgctgagtgggggtcaagatctcaccctggacggactt
gtggacctggccgtgggggcccaggggcacgcactgctgctcaggaccagacctgtgctg
agggtgtgggtgaacatccatgtaacacctgcagagattgctaggtctgtgtatgagtgt
aaggagcacacatcctctggccaggaactgggtgatgccaatgtctgccttcgcatttat
ggaagtcccaagaaccggctgggtgacctccaaagctctgtgacctttgatttgaccctg
gaccctggccgcctgaacccccgtgccattttcaaggagacaagcagtcggagtctcact
cgtgtcagagttcttgggctgggacggcactgtgaggatgtgaagttgctccttccgact
tgtgtggaagactcggtgacccccctcaccttgcgtctcaatttctccctggtgggcaac
cccatctctgcctttggaaacctccagcctatgctggctatggatgctcccagatactac
acagcctctctcccctttgagaagaactgtggagttgaccacgtctgccaggatgacctg
ggcatctcctttggtttctcaggcatgaagaccctggtggtgggaagtaacctagagctg
aacatggaagtgaaagtatggaatgatggggaggactcctatggaaccacagtcaccttc
tcctacccaacggggctgtcttatcgacgtgtggcaggcagccagagccagctgcagtca
cgctccctgcacctgacctgtgacagcgccccagccagaggccaggacagctggagcacc
cgctgcagcatcaaacaccttatcttccgtgagggtgctcagatcaccttcgtggccacc
tttgatgtctcccccaaggccatgctgggagaccggctgcttctaatggccaatgtgagc
agtgagaataacacccccaggaccagcaagaccaccttccagctggagctcccagtgaag
tatgctgtctacgccgtgatcagcagccatgaacaatccaccaagtacctcaacttctct
gcctctgaggagaagggaagcagcctggcccagcacagataccaggtgaacaacctggga
cagagggacctgcctgtcagcatcagcttcttggtgcctgtggagctgaaccaggtgact
gtgtggacagggttgaagatcctccacccccagaacccatctattcagtgctctgcagag
agaatggtgcccacagagtccaacttcctgacccacattcagaagaatcgtgtgctggac
tgttccattgctgactgcctgaggttccgctgtgacatcccctcctttggcgtccaggag
gagcttgacttcatcttgaagggcaacctcagcttcagctgggtcagccagacattgcag
aagaaggtatcggtcgtgagtgtggctgaaatcacgttcgacagatctgtgtattcccag
cttccgggacaggaggcgtttttgagagctcagatgaagatggtgctggagaagcatgag
gtccacaaccccatactcctcattgtgggcagctctgtgggagggctgctgctgttggct
cttctcacggccctactgtacaaggttggcttctttagacgtcagtacaaagagatgatg
gacgaagcaagtggacaagctgccccagaaaatgggacatcagatgcccaaggtggtcaa
taa

DBGET integrated database retrieval system