Drosophila sechellia: 6613460 Help Entry 6613460           CDS       T01064                                  Name (RefSeq) troponin C   KO K02183   calmodulin Organism dse  Drosophila sechellia Pathway dse04070   Phosphatidylinositol signaling system dse04745   Phototransduction - fly Brite KEGG Orthology (KO) [BR:dse00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     6613460  09150 Organismal Systems   09157 Sensory system    04745 Phototransduction - fly     6613460  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:dse01009]     6613460   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dse04131]     6613460    03036 Chromosome and associated proteins [BR:dse03036]     6613460   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dse04147]     6613460 Protein phosphatases and associated proteins [BR:dse01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      6613460 Membrane trafficking [BR:dse04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     6613460 Chromosome and associated proteins [BR:dse03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      6613460 Exosome [BR:dse04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    6613460 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_9 EF-hand_8 EF-hand_5 AIF-1 EH EF_EFCAB10_C DUF5580_M T2SSK SAPC2_N Polysacc_deac_2 Motif Other DBs NCBI-GeneID:  6613460 NCBI-ProteinID:  XP_002037932 UniProt:  B4I1E3 LinkDB All DBs Position 2L:5125815..5126865 Genome browser AA seq 149 aa AA seqDB search MEDDEKMDIMRKAFQMFDTQKTGFIETLRLKTILNSMGQMFDDSELQALIDDNDPEDTGK VNFDGFCSIAAHFLEEEDAEAIQKELKEAFRLYDREGNGYITTSTLKEILAALDDKLSSS DLDGIIAEIDTDGSGTVDFDEFMEMMAGE NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggaggacgacgagaaaatggacatcatgcgcaaggcattccaaatgttcgacacacaa aagacgggcttcattgagacgctgcgtctgaagacgatcctcaacagcatgggtcagatg ttcgacgacagcgaactgcaggctctgatcgacgacaacgatccggaggacaccggcaag gttaacttcgacggcttctgcagcatcgctgcccatttcctggaggaggaggatgccgag gccatccagaaggagctgaaagaggccttccgtctgtacgatcgcgagggaaatggttac atcaccacctcaacgctcaaggaaattctcgccgccctcgacgacaagctctcctccagc gatctggacggcatcatcgctgagattgacactgatggatccggtaccgttgactttgat gaattcatggagatgatggcgggcgaatag

DBGET integrated database retrieval system