KEGG   Drosophila simulans: Dsimw501_GD24857
Entry
Dsimw501_GD24857  CDS       T01065                                 
Symbol
Dsim_GD24857
Name
(GenBank) uncharacterized protein
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
dsi  Drosophila simulans
Pathway
dsi00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    Dsimw501_GD24857 (Dsim_GD24857)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:dsi00199]
    Dsimw501_GD24857 (Dsim_GD24857)
Enzymes [BR:dsi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     Dsimw501_GD24857 (Dsim_GD24857)
Cytochrome P450 [BR:dsi00199]
 Cytochrome P450, animal type
  CYP306 family
   Dsimw501_GD24857 (Dsim_GD24857)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: KMY87106
FlyBase: FBgn0196174
LinkDB
AA seq 574 aa
MSAGIVDIGHTGWMPSVQSLSVLLVPGAIVLVILYLCERQCNDIMGAPPPGPWGLPFLGY
LPFLDARAPHKSLQKLAKRYGNIFELKMGRVPTVVLSDAAVVRDFFRRDVMTGRAPLFLT
HGIMGGFGIICAQDDIWRHARRETIDWLKALGMTRRPGELRARLERRIARGVDECVRFFD
TEAKKSCASEVNPLPALHHSLGNIINDLVFGITYKRDDPDWLYLQRLQEEGVKXXXVSGV
VNFLPWLRHLPANVRNIRFLLEGKAKTHAIYDRIVEACGQRLKEKQKVFKELQEQKRLQR
QLEKEQRRQSKEADPGQEQIEADEDDEESDEEDTYEPECILEHFLTVRDTDSQLYCDDQL
RHLLADLFGAGVDTSLATLRWFLLYLAREQRCQRRLHELLLPLGPSPTLEELEPLAYLRA
CISETMRIRSVVPLGIPHGCKENFVVGDYFIKGGSMIVCSEWAIHMDPVAFPEPEEFRPE
RFLTPDGAYQAPPQFIPFSSGYRMCPGEEMARMILTLFTGRILRRFHVELPPGTEVDMAG
ESGITLTPTPHRLRFTKLPAVEMRHAPDGAVVQD
NT seq 1725 nt   +upstreamnt  +downstreamnt
atgtcggcgggcatcgtcgatattggccacaccggttggatgccctcggtgcagagcctg
agtgttctgctggttccgggtgcgatcgtcctggtgattctctacctgtgcgagcgccag
tgcaatgacatcatgggtgccccaccgccgggtccctggggcctgccctttctgggttac
ttgcctttcttggacgcccgtgcgccgcacaagtcacttcagaagctggccaagcggtat
ggcaacatcttcgaactgaaaatgggcagggtgccgaccgtagtcctctcggatgccgcc
gtggtgcgggatttctttcgccgcgatgtgatgactggccgtgctccactcttcctcacc
cacggcatcatgggtggattcggaatcatttgcgcccaggatgacatttggcgacatgcg
cgtcgcgagactatcgattggctaaaggccttgggcatgacccgtcggccgggggaactg
cgcgcccggctggagcggcgcatagcccgcggagtcgacgagtgcgtccggtttttcgat
actgaggcgaagaagagctgtgcgtcggaagtgaatccgctgccggcgctccaccactcg
ctgggcaacataatcaacgacctggtcttcgggatcacctacaagcgggacgaccccgac
tggctgtacctgcagcggctgcaggaggagggcgtcaagnnnnnnngcgtctccggggtg
gtcaactttctgccctggctgcgtcacctgcccgccaacgtgcgcaacatccgcttcctg
ctggagggcaaggccaagacgcacgccatctacgaccgtattgtggaggcctgtggccag
cggctgaaggagaagcagaaggtgtttaaggagctccaggagcagaagcggctgcaaagg
cagctggagaaggagcagcgcaggcagtcgaaggaggcggatccaggccaggagcagatt
gaggctgacgaggatgacgaggagagcgatgaggaggacacgtacgagccagagtgcatc
ttggagcacttcctcaccgttcgcgacacggactcgcagctctactgcgacgaccagctg
cgccatctgctggccgatctctttggagccggggtggacacctcactggccaccctgcgc
tggttcctgctctacttggcccgcgaacaacgctgccagcggcgcctgcatgagctcctc
ctgccgctgggtccgtctcccactttggaggaactggagccgctggcctacctaagggct
tgcatttccgagacgatgcgcatacgcagcgttgttccgctgggcattccgcacggatgc
aaagagaacttcgtcgtgggcgattatttcatcaagggcggttcgatgatcgtttgctcg
gagtgggccatccacatggacccagtggccttcccggaaccggaggagttccgtccggag
cgcttcctgacccccgatggagcctaccaggcgccgccacagttcatcccattctcgtcc
ggctaccgcatgtgtcccggcgaagagatggctcgcatgatactcacgctgttcacgggt
cgcatcctcaggcgcttccacgtggaactgcccccgggcactgaggtggacatggcgggc
gagagcggcatcaccctgacccccactccgcacaggctgcgattcaccaagctgccagcg
gtggagatgcgtcatgctcccgacggagctgtggtgcaggattag

DBGET integrated database retrieval system