KEGG   Dyadobacter sandarakinus: HWI92_21145
Entry
HWI92_21145       CDS       T07768                                 
Name
(GenBank) acylneuraminate cytidylyltransferase family protein
  KO
K24307  5-N-acetyl-7-N-(D-alanyl)-legionaminic acid cytidylyltransferase
Organism
dsn  Dyadobacter sandarakinus
Pathway
dsn00541  O-Antigen nucleotide sugar biosynthesis
dsn01100  Metabolic pathways
dsn01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:dsn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    HWI92_21145
SSDB
Motif
Pfam: CTP_transf_3
Other DBs
NCBI-ProteinID: QRR03241
LinkDB
Position
complement(5127327..5128037)
AA seq 236 aa
MHTPKVLGIIPARKQSREVPGKNSKLLNNKPLVSYTIETALQSQLLDTILVSTDSSEILE
ISRSYDKVETPFTRPAHLATDLIPSIAVVQHALDYYEATGQIFDFICLLQPTVPFRSDRI
IDRSIEEIVKCSADSLITVAPIPAKYNPLWAYRLDEHTIRPLVPESAGVFRRQDLPPFFC
RNGSVYITSAYLIKEGLITGGKMAVLMDEHENHVNIDSLADWKVAEQIALTFNENA
NT seq 711 nt   +upstreamnt  +downstreamnt
atgcacacacccaaagtactcggcattattccggcacgaaagcagtccagggaggttccc
ggcaagaacagcaagctgctcaataacaagccattggtaagttataccattgaaacagcc
ctgcaaagccagcttctggatacgatcctggtttcgacagacagctctgaaattcttgaa
ataagcagatcatatgataaggtagagacacccttcacgcgtccggcccatttggcgact
gaccttattccctcgattgccgtggtgcagcatgcgctggactactatgaagcaaccgga
caaatatttgactttatatgccttctgcaacccaccgtgcctttcagaagtgaccggatt
attgacaggagtatcgaagaaatcgtcaaatgtagtgcagatagcctgattactgtggca
cctatacccgcaaaatacaacccgctctgggcataccggcttgacgaacataccatccgg
ccgcttgtacccgaaagtgccggggtatttcgacggcaggacctccctccttttttctgc
cgtaacggatcagtttatattacctctgcgtacctgatcaaagaaggactgataactggt
gggaaaatggcagttctgatggacgaacacgaaaaccatgtcaacatagacagccttgcc
gactggaaagtcgccgagcagatcgcacttacctttaacgaaaatgcctga

DBGET integrated database retrieval system