Dermacentor silvarum: 119444771 Help Entry 119444771         CDS       T07348                                  Name (RefSeq) glutathione S-transferase 4   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism dsv  Dermacentor silvarum Pathway dsv00480   Glutathione metabolism dsv00980   Metabolism of xenobiotics by cytochrome P450 dsv00982   Drug metabolism - cytochrome P450 dsv00983   Drug metabolism - other enzymes dsv01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:dsv00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     119444771   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     119444771    00982 Drug metabolism - cytochrome P450     119444771    00983 Drug metabolism - other enzymes     119444771  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:dsv02000]     119444771 Enzymes [BR:dsv01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      119444771 Transporters [BR:dsv02000]  Other transporters   Pores ion channels [TC:1]    119444771 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_C GST_C_3 GST_N GST_N_2 GST_N_3 GST_C_2 GST_C_6 DeaD_dimer Motif Other DBs NCBI-GeneID:  119444771 NCBI-ProteinID:  XP_037565047 LinkDB All DBs Position 3:128174454..128199973 Genome browser AA seq 172 aa AA seqDB search MFSVLQINPFHKVPTLDDSGFVVYESIAIAYYLLRKYAPKSELYPECVKERTRIDQILAA VSSTIQPHKMAFFRPLFTEKRKPTSEEVAAFEENVLKGFEHLIGDRKFAVKDKFTLADIC LFSAMVGVFEMRFFNKAKFQKLSSYYERVLPEIAGYDEIFKPAITLLQERMK NT seq 519 nt NT seq  +upstreamnt  +downstreamnt atgttttctgttttgcagatcaacccgtttcacaaggtaccaactcttgacgactcggga tttgtcgtttatgagagcatcgccattgcttactacctgctacgcaagtatgctcccaag tcagaactctatccggagtgtgtgaaggagcgcacccgcatcgaccaaatcctcgccgct gtttcgtccacaattcaaccgcacaagatggcctttttccgaccgctctttaccgaaaag agaaagcccaccagcgaagaagtggcagcattcgaagaaaatgtgctcaagggttttgag caccttatcggtgaccgcaagttcgccgtcaaagacaagttcacactggctgatatctgc ctcttctcagccatggtaggagttttcgagatgcgcttcttcaacaaggccaagtttcag aagctgagcagctactacgagcgcgtcttgcccgaaattgctggctacgatgaaatcttc aagccagccatcaccctcttgcaggagcgcatgaagtga

DBGET integrated database retrieval system