KEGG   Desulfomonile tiedjei: Desti_1824
Entry
Desti_1824        CDS       T02147                                 
Name
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K21585  3-aminobutanoyl-CoA transaminase [EC:2.6.1.111]
Organism
dti  Desulfomonile tiedjei
Brite
KEGG Orthology (KO) [BR:dti00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Desti_1824
Enzymes [BR:dti01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.111  3-aminobutanoyl-CoA transaminase
     Desti_1824
SSDB
Motif
Pfam: Aminotran_3
Other DBs
NCBI-ProteinID: AFM24532
UniProt: I4C4P1
LinkDB
Position
complement(2188934..2190181)
AA seq 415 aa
MKEMEKLNITKSRELFDEATTLIPGGVLGARKPADFIDGEYPIFLETGKGCRLTDVDGNE
FIDFLCGYGPIILGYREEEVDEAVYRQIRDKGFCFTLTQKYQNLLARKLTELVPSSELSI
FLKTGSDATSASIRIARAYTNKLRVMRCGYHGWHDWCVEMKGGIPAKMYEDVFEFQYNNL
DQLEDLMTKHGNDTAAIIMTPFGHPNHQKMQVPNPGFLEGVREIANRYGTVLIYDEIRTG
FRLSMGGAQKLYGVTPDLSVLGKAIANGYPISVVTGKKEVMMAAAHKLFISSTFFPNSDA
FIAALKTIEILERDNVLDNIWEKGGRFIRQIQQLIDKHDVGAELTGVAPMFYLTFRKDET
GAYKTKRTDFYAQLIRRGFFFSPFHHGYINYRHTEEDLRLTLDAIDQSLALLKQK
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgaaagaaatggaaaaactgaatatcaccaaaagccgtgagctgttcgatgaagcaact
acattgattcccggtggcgttctgggtgctagaaagccggccgatttcattgatggagag
tatccaatctttcttgaaaccggaaaaggctgtcgtcttaccgatgtcgatggcaatgaa
ttcatcgattttctttgcggttatggtcccataatcctggggtaccgtgaagaagaggtg
gacgaagcagtctacaggcagataagagacaagggattttgttttacactgactcaaaaa
taccagaatctgctcgccaggaagcttacggaattggtgccctcttccgagctgagtatc
tttttgaaaacaggctctgatgccaccagcgcaagtatccgtatcgcgagggcgtacacg
aataaactcagagtaatgcgctgcggatatcacggatggcatgactggtgtgttgaaatg
aaaggcggaatacctgccaaaatgtacgaggatgtctttgagtttcagtacaacaacctt
gaccagttagaagatttgatgacaaaacacggcaacgacaccgcggctatcatcatgact
cctttcggccatcccaatcatcaaaagatgcaggtcccgaatcccggattcctcgaaggt
gtaagggaaattgccaacaggtatgggactgtgttgatttatgatgaaattcgcaccggg
tttcggctttcaatgggcggagctcagaaactctatggagtcacgcccgatctgagtgtc
cttggaaaggcaatcgccaacggttatcccatttcggtagtaacagggaaaaaggaagtt
atgatggcggctgcccacaagctcttcatctcttcgacgtttttccccaacagcgatgcc
ttcatagcagcgctcaagacgatagaaatccttgagcgggacaatgtgctcgacaatatc
tgggagaaaggcgggagatttatccggcaaatccagcagttaatcgacaagcacgacgtg
ggagccgaactgaccggagtcgccccgatgttctacctcacctttaggaaggatgagaca
ggtgcatacaaaaccaaacgaacggatttttacgcacaactcatccgaagagggttcttt
ttctcgcctttccatcacgggtatatcaattatcggcacaccgaggaggacttgagattg
accttggacgcaatcgatcaatccctggccctgctgaagcaaaaataa

DBGET integrated database retrieval system