KEGG   Dactylosporangium vinaceum: Dvina_05845
Entry
Dvina_05845       CDS       T07478                                 

Name
(GenBank) SDR family oxidoreductase
  KO
K15944  nogalaviketone/aklaviketone reductase [EC:1.1.1.- 1.1.1.362]
Organism
dvc  Dactylosporangium vinaceum
Pathway
dvc01057  Biosynthesis of type II polyketide products
dvc01100  Metabolic pathways
dvc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dvc00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    Dvina_05845
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:dvc01008]
    Dvina_05845
Enzymes [BR:dvc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.362  aklaviketone reductase
     Dvina_05845
    1.1.1.-  
     Dvina_05845
Polyketide biosynthesis proteins [BR:dvc01008]
 Polyketide tailoring proteins
  Others
   Dvina_05845
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase 3HCDH_N
Other DBs
NCBI-ProteinID: UAB97648
LinkDB
Position
complement(1319429..1320205)
AA seq 258 aa
MSQPVRAEPPRPAPQRPAVVVTGGGTGIGRATAHLFAKEGADVLVVGRQAGPLEETAAGH
PAVRTFVQDITAPGGAAAVVAAALDAFGRIDVLVNNAGIIRPAMLGEVDWDRAHRQIATN
LIAPLFLAQEAFPHMRPGAVIVNVTSNPAGKGWPGNCVYGSTKVALDFFTNTWAVELGGR
GIRVVSVAPGVTDTPVLVHADLPAEERAARRRRYNARVPLGRTAQPEEIAWWIVQAARPE
ASYLTGSVLRVDGGIGVC
NT seq 777 nt   +upstreamnt  +downstreamnt
atgtcgcagcctgtgagggccgagccaccccgccccgcgccgcagcgtcccgcggtcgtc
gtgaccggcggcgggaccggcatcggccgggccaccgcgcacctgttcgccaaggagggc
gccgacgtcctggtcgtcggccgccaggccggtccgctggaggagaccgccgccgggcac
ccggccgtgcggaccttcgtccaggacatcactgcgccgggcggggcggccgccgttgtc
gcggccgcgctcgacgcgttcggccggatcgacgtgctcgtcaacaacgccgggatcatc
cggcccgcgatgcttggcgaggtcgactgggaccgggcgcaccggcagatcgcgacgaac
ctgatcgcgccgctgttcctggcccaggaggcgtttccgcacatgcggccgggcgccgtg
atcgtcaacgtgacctccaacccggccggcaaggggtggccgggcaactgcgtctacggc
agcaccaaggtggccctcgacttcttcaccaacacgtgggcggtcgagctcggcgggcgc
ggcatccgggtggtctccgtcgcgccgggggtcaccgacaccccggtgctcgtccacgcc
gacctcccggccgaggagcgggcggcgcggcgccggcggtacaacgcccgcgtgccgctc
gggcgcaccgcccagccggaggagatcgcctggtggatcgtgcaggcggcccggcccgag
gcgtcgtacctcaccggctccgtcctgcgcgtcgacggcgggatcggcgtgtgctga

DBGET integrated database retrieval system