Desulfosarcina widdelii: DSCW_38060 Help Entry DSCW_38060        CDS       T06303                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism dwd  Desulfosarcina widdelii Pathway dwd01100   Metabolic pathways dwd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dwd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DSCW_38060   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DSCW_38060 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  BBO76389 UniProt:  A0A5K7Z898 LinkDB All DBs Position complement(4086146..4086409) Genome browser AA seq 87 aa AA seqDB search MTRDEIQKAIIAIFADQFEIDNPGLEDDLREVHEFDSIDAIELLREIEILLGAQLSRDEK KAAMEIRTINQIVDYVVGLDARRRSED NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgacacgcgacgagatccagaaggcgatcatcgccatttttgccgatcagttcgagatc gacaatccagggttggaagacgacctgcgggaagtacacgaattcgacagcatcgacgcc atcgaactgctgcgggagatcgagatcctgctgggcgctcagttgtcccgagacgagaaa aaggcggcaatggagatccgtaccatcaaccagatcgtggattatgtggtggggttggac gcaagacggaggtcggaagactga

DBGET integrated database retrieval system