Desulfosarcina widdelii: DSCW_39670 Help Entry DSCW_39670        CDS       T06303                                  Symbol atpE_1 Name (GenBank) ATP synthase subunit c   KO K02110   F-type H+-transporting ATPase subunit c Organism dwd  Desulfosarcina widdelii Pathway dwd00190   Oxidative phosphorylation dwd01100   Metabolic pathways Module dwd_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:dwd00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     DSCW_39670 (atpE_1)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:dwd00194]     DSCW_39670 (atpE_1) Photosynthesis proteins [BR:dwd00194]  Photosystem and electron transport system   F-type ATPase [OT]    DSCW_39670 (atpE_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  BBO76550 UniProt:  A0A5K7Z724 LinkDB All DBs Position 4252053..4252301 Genome browser AA seq 82 aa AA seqDB search MAIEGADIVKAAAFLGAGISMGLGAIGPGVGEGMVAAKACEAIGKNPKEAGLLTRTMLVG QAVSESTGIYSLVIALLLLFVV NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccattgaaggggcagacattgttaaggcagcggcttttcttggagccggcatttcc atgggattgggcgccatcggccccggagtgggcgagggcatggtggccgccaaagcatgc gaagccatcggcaagaatcccaaagaggcgggattgttgacccggaccatgctggtgggg caggcggtgtccgaatcgaccggtatttactccctggtgattgccctgctgctgctgttc gtggtctga

DBGET integrated database retrieval system