KEGG   Drosophila willistoni: 6648608
Entry
6648608           CDS       T01067                                 
Name
(RefSeq) cytochrome P450 306a1 isoform X1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
dwi  Drosophila willistoni
Pathway
dwi00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    6648608
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:dwi00199]
    6648608
Enzymes [BR:dwi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     6648608
Cytochrome P450 [BR:dwi00199]
 Cytochrome P450, animal type
  CYP306 family
   6648608
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 6648608
NCBI-ProteinID: XP_002071819
FlyBase: FBgn0212206
UniProt: B4ND96
LinkDB
Position
Unknown
AA seq 513 aa
MESLESEDSSWFNYSLSLLLGPGLLLILIMWICEHHHDNILGKRPPGPWGIPLLGYLPFL
NAKQPHKSLQKLAEYYENGIFQLRMGGIQTVVLSDAQLVREFFRHEELTARAPLYLTHGI
MGGYGIICAAGAIWKHQRRQIIDWLKALGMSRRPSEMRKQLEQRIGLGVDECVQLYARQL
ETEMEFDPLPALQHTLGNIINDLVFGLKYERKDTNWLYLQQLQEEGVKLIGVSGMVNFVP
WLRHLSFNKKNIKFLLDGKSKTHDIYDRIVNECEKRMKENAGQPPRCILEHFLRERQPHS
ELYCQEQLRHLLADLFGAGVDTALATLRWFLLYMACNPDIQRQLRSHLRHLSSTPSLEEL
EPLTYLRACISEVQRIRSVVPLGIPHGTEKDINIAGYRIQKGSMIVSLQWAIHMNPKHWP
QPEEFRPKRFLNDEDEYVAPAQFIPFQNGKRMCPGDELARMMLTLFAGRILRKFQLEMIH
DYADMNMDGECGITLAPAAYKLKFIKVDEEPMK
NT seq 1542 nt   +upstreamnt  +downstreamnt
atggagtcacttgagtccgaggatagttcttggttcaattatagtttgagcctcttactt
ggtcctggcttacttttaattctaattatgtggatttgcgagcatcatcatgataatatt
ttgggtaaaagaccaccaggaccttggggtataccccttctaggatatttgccatttctc
aatgccaagcagccacataagagcctacaaaagctagctgaatactatgaaaatggaatt
ttccaattacgcatgggtggcattcagacagttgtcctttcggatgcccaactcgtgcgt
gagttttttcgccacgaagaattgacggcacgagctccactctatttaacacacggcatt
atgggcggatatgggatcatttgtgctgctggcgctatatggaagcatcagcggcgtcag
atcattgattggctaaaggctttgggcatgagtcgacgtcccagcgagatgcgtaagcaa
ctggagcagcgtattggactcggtgtcgatgagtgtgtgcagttatatgcccgccagttg
gagacggaaatggaattcgatccgttgcctgctctacagcatacactaggcaacataatc
aatgacttggtattcggtttgaaatatgaacgtaaggacacgaactggttgtatttgcag
caattgcaggaggaaggtgtcaagctgattggtgtctctggcatggtcaattttgtgcca
tggctgaggcatttgtcgtttaataaaaagaacattaagtttctgctcgatggtaagtca
aagacacacgacatttacgatcgcattgtgaacgaatgtgagaagcgtatgaaggagaat
gcgggtcagccaccgcgatgtatccttgagcattttctacgcgaacgccaaccacactcg
gagttgtattgtcaggagcaattgcgtcatcttttggctgatctctttggtgctggtgtc
gacacggcgttggccacattgcgttggtttctgctctacatggcctgcaatccggatata
cagcggcagttgcgatctcatctaaggcatctgagttcaacacctagcctggaggagctg
gaaccattgacatatctgcgtgcctgcatatcggaggtgcaaaggatacgaagtgttgtc
cccttgggcataccgcatggcactgaaaaggacattaatattgccggctatcgcattcag
aaaggcagcatgattgtctctctacaatgggccattcacatgaatcccaaacattggcca
cagcccgaagagtttcgtccgaagcgttttctcaacgatgaggacgaatatgtggccccc
gcacaatttataccatttcagaatggcaaacgtatgtgtccaggtgatgaattggctcgc
atgatgttaaccctatttgccggacgtattctaaggaaatttcaactagaaatgatccac
gattatgctgatatgaatatggatggtgaatgtggcataactctagcaccagctgcctac
aaattgaagttcatcaaagtagacgaagagcctatgaaataa

DBGET integrated database retrieval system