KEGG   Drosophila yakuba: Dyak_GE17743
Entry
Dyak_GE17743      CDS       T01068                                 
Name
(GenBank) uncharacterized protein
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
dya  Drosophila yakuba
Pathway
dya00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:dya00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    Dyak_GE17743
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:dya00199]
    Dyak_GE17743
Enzymes [BR:dya01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     Dyak_GE17743
Cytochrome P450 [BR:dya00199]
 Cytochrome P450, animal type
  CYP306 family
   Dyak_GE17743
SSDB
Motif
Pfam: p450 ABC_trans_N
Other DBs
NCBI-ProteinID: EDX02756
FlyBase: FBgn0235189
UniProt: B4PWD8
LinkDB
Position
X
AA seq 581 aa
MSADIVDVVGGYTGWMPSVQSLSFLLVPGALVLVILYLCEREYDDILGVSPPGPWGLPLL
GYLPFLDGRAPHKSLQKLAQRYGGIFELKMGRVRTVILTDAALVRDFFRRDVMNGRAPLY
LTHGIMGGFGIICAQLDIWRHARRETIDWLKALGMTRRPGELRARLERRIARGVNECVQL
FESEAKKSCASEVDPLPALHHSLGNIINDLVFGITYKRNDPDWLYLQRLQEEGVKLIGVS
GVVNFLPWLRHLPANKRNIRFLLEGKAKTHAIYDRIVEACLQRLREKQQVFKELQEQKRL
QRQLAKEQRRQSKEASANQERIEPEIAADEDDEEESDEEDKFEPESILEHFLVVRDTDSQ
LYCDDQLRHLLADLFGAGVDTSLATLRWFLLYLAREQRCQRRLHELLLPLGPSPSLEELE
SLAYLRACISETMRIRSVVPLGIPHGCKEEAIMGDYNIKGGSMIVCLEWAIHMDPVAFPE
PEQFRPERFLTPEGSYQAPPQFIPFSSGYRMCPGEDMARMILTLFTGRILRRFHLELPPG
TEVDMAGESGITLTPVPHKLRFTKLPAVEMRHEPDGSVLQD
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgtcggcggacatcgtggatgttgttggcggctacaccggttggatgccctcggtgcag
agcctcagttttctgctggttccgggtgcgctcgtcctggtgattctgtacctgtgcgag
cgcgagtacgatgacatcctgggcgtctcaccgccgggtccctggggcctgccccttctg
ggctatctgcccttcctggacggacgggcgccgcacaagtcactccagaagctggcccag
cgctatggcggcatctttgagctgaaaatgggcagggtgcgtaccgtaatccttacggat
gccgccttggtgcgggatttctttcggcgcgatgtgatgaatggccgggctccgctctac
ctcacacacggcatcatgggtggatttggaatcatctgcgcccagcttgacatttggcga
catgcgcggcgcgagactatcgattggctgaaggccttgggcatgacccgtcggccgggg
gaactgcgtgcccggctggagcgccgcatcgcccgcggcgtcaacgagtgcgtccagctg
ttcgagagtgaggcgaaaaagagctgtgcatcggaggtggatccgctgccggcgctccat
cactcgctgggcaacataatcaacgacctggtcttcgggatcacctacaagcggaacgat
cccgactggctgtacctgcagcggctgcaggaggagggcgtcaagctgattggcgtctcc
ggggtggtcaacttcctgccctggctgcgtcatctgcccgccaacaagcgcaacatacgc
ttcctgctggagggcaaggccaagacgcacgccatctacgaccgcattgtggaggcctgt
ttgcagcggctgagggagaagcagcaggtgttcaaggagctgcaggagcagaagcgactg
caaaggcagctggcgaaggagcagcgccggcagtcaaaggaggcgagtgcaaaccaggag
cgcattgagcccgaaattgcggcggacgaggatgacgaggaggagagcgacgaggaggat
aagttcgagccggagagcatactggagcacttccttgtcgtacgcgatacggactcgcag
ctctactgcgacgaccaactgcgtcatctgctggccgatctctttggcgccggagtggac
acctcgctggccaccctgcgctggttcctgctctacttggcccgcgaacagcgctgccag
cggcgactgcatgagctcctcctgccgctgggtccgtcgcccagcttggaggaactggag
tcgctggcctatctgcgcgcttgcatttccgaaacgatgcgcatacgcagtgttgtgcca
ctgggcattccgcacggatgcaaagaggaagccatcatgggcgattataacatcaagggc
ggttcgatgatcgtttgcctggagtgggccattcacatggacccggtggccttcccggaa
ccggagcagttccgtccggagcgcttcttgacgcccgaaggcagctaccaggcgccgcca
cagttcatcccattctcgtcgggctaccgcatgtgtcccggcgaggacatggctcgcatg
atactcacgctattcacgggccgcatcctgaggcgcttccacttggagctgcccccgggc
acagaggtggacatggcgggcgagagcggcatcaccctgacccccgttccccacaagctg
cgattcaccaagctgccggcggtggagatgcgccatgaacccgacggatccgtgctgcag
gattag

DBGET integrated database retrieval system