Durio zibethinus (durian): 111275111 Help Entry 111275111         CDS       T05242                                  Name (RefSeq) protein MHF2 homolog   KO K15360   centromere protein X Organism dzi  Durio zibethinus (durian) Pathway dzi03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:dzi00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     111275111  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:dzi03400]     111275111 DNA repair and recombination proteins [BR:dzi03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      111275111 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-X Motif Other DBs NCBI-GeneID:  111275111 NCBI-ProteinID:  XP_022716000 UniProt:  A0A6P5WIP9 LinkDB All DBs Position Unknown AA seq 109 aa AA seqDB search FAIDDNNNAPTFEPDLIRAIFKHIWARKAQERERNEMENTRPKTVGAGTSKKNRPTSSNA NALKLSCELLRIFITGSVQRASTIAEAEGGTKIEATHLERILPQLLLDF NT seq 330 nt NT seq  +upstreamnt  +downstreamnt ttcgccatcgacgacaacaacaacgctccaactttcgaacctgatttgattagagccatt ttcaagcacatttgggccagaaaagctcaagagcgtgaaagaaatgaaatggaaaacacc aggccgaagactgttggagctggaacatccaagaagaatcgacccacttcctctaatgca aatgctctaaagctgagttgtgaacttcttcgaatttttattacagggtctgtgcagcga gcttctacaattgctgaagctgagggtggtactaagattgaagcaactcatttagaaagg attcttcctcaattacttcttgatttttaa

DBGET integrated database retrieval system