Escherichia coli ABU 83972: ECABU_c10130 Help Entry ECABU_c10130      CDS       T01995                                  Name (GenBank) hypothetical protein   KO K22501   cytochrome bd-II ubiquinol oxidase subunit AppX [EC:7.1.1.7] Organism eab  Escherichia coli ABU 83972 Pathway eab00190   Oxidative phosphorylation eab01100   Metabolic pathways eab02020   Two-component system Module eab_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:eab00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     ECABU_c10130  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     ECABU_c10130 Enzymes [BR:eab01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      ECABU_c10130 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Adeno_E3B Motif Other DBs NCBI-ProteinID:  ADN45586 LinkDB All DBs Position 1059059..1059151 Genome browser AA seq 30 aa AA seqDB search MWYLLWFVGILLMCSLSTLVLVWLDPRLKS NT seq 93 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttactttggttcgtcggcattttgttgatgtgttcgctctccacccttgtg ttggtatggctggacccgcgtctgaaaagttaa

DBGET integrated database retrieval system