Klebsiella aerogenes KCTC 2190: EAE_05595 Help Entry EAE_05595         CDS       T01529                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism eae  Klebsiella aerogenes KCTC 2190 Pathway eae01100   Metabolic pathways eae01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eae00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EAE_05595   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EAE_05595 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Lmo2446_N_CBM-like Motif Other DBs NCBI-ProteinID:  AEG96046 UniProt:  A0A0H3FNH8 LinkDB All DBs Position 1154168..1154425 Genome browser AA seq 85 aa AA seqDB search MEALYLEIKNLIISTLNLDELSADDIDTDAALFGDGLGLDSIDALELGLAVKKQYGVVLS AESEEMRQHFFSVATLASFIQAQRA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggaagcgctctatcttgaaattaaaaatctaattatcagtacattgaacctggacgag ttgtccgctgatgatatcgacaccgatgccgcgctgtttggcgatggtctgggtctggac tccatcgatgcgctggagctgggtctggcggtgaaaaaacagtacggcgtggtgctgtcg gcagaaagcgaagagatgcgccagcacttcttttccgtcgccacgctggcatcctttatt caagcgcagcgtgcctga

DBGET integrated database retrieval system