Klebsiella aerogenes KCTC 2190: EAE_16380 Help Entry EAE_16380         CDS       T01529                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism eae  Klebsiella aerogenes KCTC 2190 Pathway eae01100   Metabolic pathways eae01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eae00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EAE_16380   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EAE_16380 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1896 TerB DUF1493 HLH Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AEG98187 UniProt:  A0A0H3FZ81 LinkDB All DBs Position 3536230..3536466 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttccttcgttgaagacctgggcgctgattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggtcaccaggcgtaa

DBGET integrated database retrieval system