KEGG   Eurytemora affinis: 111709794
Entry
111709794         CDS       T07296                                 
Name
(RefSeq) cytochrome P450 306a1-like
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
eaf  Eurytemora affinis
Pathway
eaf00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:eaf00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    111709794
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:eaf00199]
    111709794
Enzymes [BR:eaf01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     111709794
Cytochrome P450 [BR:eaf00199]
 Cytochrome P450, animal type
  CYP306 family
   111709794
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 111709794
NCBI-ProteinID: XP_023339469
LinkDB
Position
Unknown
AA seq 283 aa
MMGVSNVVNFLPWFRFFPYNVRNIRWIKKGQVETHVEYERVIREREVRLEEGMEPECITD
FYLQEVQERNKAGLNLKSFTRNQLYHLQADMFGAGTDTTVTSILWNLLILSSKGRNDLQK
RIHEELDKGRQDQTQVSLLRAATLEVARLRPVTPLGVPHGALASLQVGDWRVKKGTMLLP
NHWSINRDPSVWKNPEKFDEKRFLDPTVSFKIFPFQTGKRRCIGADPARDIVEGVLSHIL
KVYHVELEPDVDPWHDPRHGFTLEPQKFRVKFTKRVPTLKNQL
NT seq 852 nt   +upstreamnt  +downstreamnt
atgatgggagttagtaatgttgttaacttccttccttggttcaggttcttcccttataac
gtgaggaacataagatggattaagaagggtcaggttgagacccacgtggagtatgagagg
gtgatcagggagagggaggtcagattggaggagggaatggaaccagagtgcatcacagac
ttctacttgcaagaggtgcaggaaagaaataaagccggactgaacctaaaatccttcacc
agaaaccaactttaccatttacaggctgatatgtttggtgctggcacagatacaactgta
acttcaatcttatggaatctgctgatcttgtccagtaaaggacgaaatgatttgcagaaa
agaattcacgaggagctagataagggacgtcaagatcaaactcaggtttcccttcttaga
gcagctaccctagaggtggcaagactgcgtcctgtcactcctttaggggttcctcatggt
gcccttgcaagccttcaggttggagactggagagtaaagaaaggaaccatgcttcttcca
aaccattggtcgattaacagagatccaagtgtctggaagaaccccgaaaagtttgacgag
aaaagattcttggacccaactgtgtctttcaaaatattcccttttcagacaggaaaacga
cggtgcattggcgcagacccggcacgtgatattgtagaaggagttctttcccacatactc
aaggtctaccatgtcgagcttgagcctgatgttgatccttggcatgatcctcgtcatggg
ttcaccctggaacctcagaaatttcgtgtcaagtttacgaagagagtcccaaccttgaag
aatcaactttaa

DBGET integrated database retrieval system