KEGG   Equus asinus (ass): 106822410
Entry
106822410         CDS       T04645                                 
Name
(RefSeq) melanocortin-2 receptor accessory protein isoform X2
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
eai  Equus asinus (ass)
Pathway
eai04927  Cortisol synthesis and secretion
eai04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:eai00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    106822410
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106822410
SSDB
Motif
Pfam: MRAP FixQ
Other DBs
NCBI-GeneID: 106822410
NCBI-ProteinID: XP_014683084
LinkDB
Position
18:complement(18782468..18803314)
AA seq 219 aa
MESSACIVKLSGPPPTFLPVHGSDKWAGLEPGDPQTHWMVLQKSVRPSPRRAPRSSGCAA
DMANQTNTSAPFYSYEYYLDYLDLIPVDERKLKANKHSIVIVFWVSLAAFVVLLFLILLY
MSWSGSPQTRDNTQHHPTCPWSHSLNLPFCVRRHPLHHRDPRGTPQAPPSSAEEPGSRAS
GRDQQPQGESPSALSPTAPQAHCALLWELTPDGDPHRVS
NT seq 660 nt   +upstreamnt  +downstreamnt
atggagagctctgcttgcatagtgaagctgtcaggcccacccccgacctttctcccagtc
cacggctctgataagtgggcaggccttgagcctggagacccacagacacactggatggtt
ttacagaaatcagtgaggccgtctcctcgtagggctccgaggagctccggatgcgctgca
gacatggccaaccagaccaacacctccgccccattctacagctacgaatattacctggac
tacctggacctcattcccgtggatgagaggaagctgaaagccaacaagcattccatcgtc
atcgtcttctgggtgagcctggcggccttcgtggtgcttctcttcctcatcctgctctac
atgtcctggtcgggctccccgcagacgagggacaacacccagcaccacccaacatgtccc
tggagtcacagcctcaacctccccttctgtgtccggaggcacccactgcaccacagggac
cctcgggggaccccgcaggctccaccgagctcggctgaggaaccaggcagcagagcatcc
ggccgcgatcagcagccgcagggagagagcccctctgccttgtcccccacagccccccag
gcccactgtgccctcctctgggaactgacccctgatggggacccccaccgcgtcagctga

DBGET integrated database retrieval system