KEGG   Equus asinus (ass): 106831870
Entry
106831870         CDS       T04645                                 
Name
(RefSeq) integrin alpha-X
  KO
K06462  integrin alpha X
Organism
eai  Equus asinus (ass)
Pathway
eai04610  Complement and coagulation cascades
eai04810  Regulation of actin cytoskeleton
eai05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:eai00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106831870
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    106831870
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    106831870
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:eai04515]
    106831870
   04090 CD molecules [BR:eai04090]
    106831870
Cell adhesion molecules [BR:eai04515]
 Integrins
  Integrin alpha subunits
   106831870
CD molecules [BR:eai04090]
 Proteins
  106831870
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_3 Integrin_alpha VWA_CoxE
Other DBs
NCBI-GeneID: 106831870
NCBI-ProteinID: XP_014697814
LinkDB
Position
14:complement(38972545..38993621)
AA seq 1166 aa
MSDLPVMTRTRTSLLLLMALASSLCFNLDMDQPTTFRMDSAGFGHSVVQYANSWVVVGAP
REIKATNQTGGLYQCDYSTASCEPIPLQVPPEAVNMSLGLSLAAATNPSQLLACGPTVHH
TCRENVYLTGFCFLLASGSWQAQRLPAALQECPRQEHDIVFLIDGSGSIYFKDFAKMLSF
VKAVMSQFQRPSTQFSLMQFSNKFFVHFTFKDFMDSSDPLGLLNSVSQLRGLTHTASAIQ
VVIKQLFSATRGARKDASKILIVITDGQKQGDHLGYDDVIPMAEAAGIIRYAVGVGSAFQ
STQAWQELNDIASKPSHEHIFKVDDFDALRDIQNQLKEKIFAIEGTQTVSSSSFELEMSQ
EGFSTVFTPDGPVLGAVGSFDWSGGAFLYPPKMSRTFINVSQEEVDMRDSYLGYSTELAT
WQGVQSLVLGAPRHQHTGKVFIFTQQSRQWRPKANVIGTQIGSYFGASLCSVDVDRDGSS
DLVLIGAPHYYMQTQGGQVSVCPLPRGRAKWQCEAVLRGEQGHPWGRFGAALTVLEDVNG
DKLTDVAIGAPGEQENQGAVYLFHGTSGLGISPSHSQRIAASQLSPRLQYFGQSLSGGQD
LTMDGLVDLAVGAQGHALLLRTRPVLRVWVSIRITPAEIARSVFECQEQKPSVRALGDAD
VCLRIYQSPKNRLGDLQSSVTFDLTLDPGRMNPRAIFEETKTWNLTRVRVLGLNQHCETV
KLLLLACVEDTVTPITLRLNFSLEGKPIPSFGSIRPVLAVDAQRYFTASLPFEKNCGADH
VCQDDLGISFHFSGLKTLVVGNNLELNMEVTVRNDGEDSYGTTVTFFYPPGLSYRRVAEG
QNQLQPRSLRLTCDSALADGQGTWRTRCSINHLILREGAQITFTATFDVSPKAVLGDRLL
LTANVSSENNTPRTSKTTFQLELPVKYAVYIVIHSPEQSTKYLNFSASEEKESSRAQHRC
QVNNLGQRDLPVSINFLVPVELNRVAVWTEMEVFHPQNPAIQCPSERIAPTESDFLTHLQ
KNPVLDCSIADCLRFRCDIPSFGIREELDFILKGNLSFGWVSQTLQKKVLVVSVAEITFN
RSVYSQLPGQEAFLRAQMETVLEKYEVYNPIPVIVGSSVGGLLLLALITAILYKVGFFKR
QYKEMMREANGHTVPENGTSDPQVAQ
NT seq 3501 nt   +upstreamnt  +downstreamnt
atgtctgaccttccagttatgaccaggaccaggacatctctcctcctgttgatggccttg
gcttcctctctctgcttcaacttggacatggaccagccaacaaccttccgcatggacagt
gctgggtttggacacagcgtggtccagtacgccaactcctgggtggtggttggagccccc
cgggagataaaggctaccaaccaaacaggcggcctttaccagtgtgactacagcacagcc
tcatgtgagcccatccccctgcaggtccccccagaggctgtgaacatgtccttgggcctg
tccctggcggctgccaccaacccctctcagctgctggcctgtggccctaccgtgcaccac
acctgcagagagaatgtgtacttgaccgggttctgcttcctgctggcctccggatcctgg
caggcccagaggctccccgctgccctgcaggagtgcccgaggcaagagcacgacattgtg
ttcctgatagacggctcaggcagcatctacttcaaggattttgccaagatgctgagcttc
gtgaaggctgtgatgagccagttccagagacccagcacccagttctccctgatgcagttc
tccaacaaattcttcgtgcacttcactttcaaagacttcatggacagctcagacccacta
ggcctgttgaattctgtatcccagctgagagggttgactcacacagcctcagccatccag
gtggttataaaacaactgttcagtgctacaagaggggcccgaaaggatgcctccaagatc
ctcatcgtcatcaccgatgggcagaaacaaggcgaccacctgggttatgacgatgtcatc
cccatggctgaggcagcaggcatcatccgttacgcagttggggtgggatcggcttttcaa
agcacacaagcctggcaagaattaaatgacattgcatcgaagccctcccatgaacatata
tttaaagtggatgactttgatgctttgagagacattcaaaatcaattgaaagagaagatc
tttgccattgagggtacgcagactgtaagcagtagttcctttgaattggagatgtcccag
gagggcttcagcactgtgttcacgcctgatgggccagttttgggggctgtgggaagcttt
gactggtctggaggtgccttcctatacccaccaaagatgagccgcaccttcatcaacgtg
tctcaggaggaagtggacatgagagactcttacctgggttactccaccgagctggccact
tggcagggggtgcagagcctggtcctgggggccccccgccatcagcacaccgggaaggtt
ttcatcttcacccagcagtccaggcagtggaggccaaaggctaacgtcataggcactcag
atcggctcctattttggggcctccctgtgctctgtggatgtggacagagatggcagctct
gacctggtcctcatcggggctccccactactatatgcagacgcaggggggccaggtgtct
gtgtgccccttgccccgggggagggccaagtggcagtgtgaggctgttctccgtggggag
cagggccacccctggggccgctttggggcagccctgacagtgctggaggatgtgaatggg
gacaagctgacggacgtggccatcggggcccccggagagcaggagaaccagggtgctgtc
tacctatttcatggaacctcaggactgggcatcagcccctcccacagccagaggattgca
gcctcccagctctcccccaggctccagtattttgggcagtcgctgagtgggggtcaggat
ctcaccatggatggactggtggacctggctgtgggggcccaggggcacgcgctgctgctc
aggactagacccgtgcttagggtgtgggtgagcatccgcatcacacctgcagagattgcc
aggtctgtgtttgagtgtcaggagcagaagccctctgtccgtgccctgggtgacgccgat
gtctgccttcgtatttatcaaagtcccaagaaccggctgggtgacctccaaagctctgtg
acctttgacctgactcttgatcctggccgcatgaatccccgtgccatctttgaggagaca
aagacctggaatctgactcgtgtccgagtccttgggctgaaccagcactgtgagaccgtg
aagttgctcctcctggcctgtgtggaggacacagtgacccccatcaccttgcgtctcaac
ttctccctggagggcaagcccatcccttcctttggaagcatccggcctgtgctggctgtg
gatgctcagagatacttcacagcctctctcccctttgagaagaactgtggagctgaccat
gtctgccaggacgaccttggcatctcctttcacttctcaggcttgaagaccctggtggtg
gggaataacctggagctgaacatggaagtgacagtgcggaatgatggcgaggactcctat
ggaaccacagttacctttttctaccctccagggctgtcttatcgacgtgtggcagagggc
cagaaccagctgcagccacgctcgctgcgcctgacctgtgacagtgccctggctgatggg
cagggcacttggaggacccgctgtagcatcaaccacctcatcttgcgtgagggcgcccag
atcacattcacggccacgtttgacgtctcccccaaggccgtgctaggagaccggcttctt
ttgacggccaatgtgagcagtgagaataacacccccaggaccagcaagaccaccttccag
ctggagctcccagtgaagtacgctgtctacatcgtgatccacagccctgaacaatccacc
aagtacctcaacttctcagcctcagaggagaaggaaagcagcagggcccagcatagatgt
caggtgaacaacctgggacaaagggacctgcctgtcagcatcaacttcttggtgcctgtg
gagctgaaccgggtggctgtatggacagagatggaggtcttccacccccagaatccagcc
attcagtgtccttcagagagaatagcacccacagagtctgacttcctgacccaccttcag
aagaatcctgtgctggactgctccattgctgactgcctgaggttccgctgtgacatcccc
tccttcggcatccgggaggaacttgacttcatcctgaagggcaaccttagctttggttgg
gtcagccagacattgcagaagaaagtattggtcgtgagtgtggccgaaatcacgttcaac
agatctgtgtattcgcagcttccaggacaggaggcatttttgagagcccagatggagacg
gtgctagagaagtatgaggtctacaaccccatccccgttattgtgggcagctctgtggga
ggactgctgctgctggctctcattacagccatactgtacaaggttggcttcttcaaacgt
cagtacaaggaaatgatgcgggaagcaaatggacacactgtcccagaaaatgggacatca
gacccccaagttgcccaataa

DBGET integrated database retrieval system