Equus asinus (ass): 106837826 Help Entry 106837826         CDS       T04645                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism eai  Equus asinus (ass) Pathway eai04613   Neutrophil extracellular trap formation eai05034   Alcoholism eai05202   Transcriptional misregulation in cancer eai05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:eai00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     106837826  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     106837826   09163 Immune disease    05322 Systemic lupus erythematosus     106837826   09165 Substance dependence    05034 Alcoholism     106837826  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:eai03036]     106837826   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eai04147]     106837826 Chromosome and associated proteins [BR:eai03036]  Eukaryotic type   Nucleosome assembly factors    Histones     106837826 Exosome [BR:eai04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106837826 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  106837826 NCBI-ProteinID:  XP_014707043 UniProt:  A0A8C4LYJ8 LinkDB All DBs Position 8:101622152..101623200 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgcactaagcaaactgctcggaagtccaccggcggcaaagcgccccgcaagcag ctggccaccaaggcggctcgcaaaagcgcgcctgccacgggcggcgtgaagaagccccac cgctaccggcccggcacggtggctctgcgcgagatccgccgctaccagaagtccaccgag ctgctgatccgcaagctgcccttccagcgcctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtgatggcgctgcaggaggcgtgcgaggcctac ctggtggggctcttcgaggacaccaacctgtgtgccatccacgccaagcgcgtcactatc atgcccaaggacatccagctcgcgcgccgcatccgcggggagagggcgtaa

DBGET integrated database retrieval system