Equus asinus (ass): 106844892 Help Entry 106844892         CDS       T04645                                  Symbol MAX Name (RefSeq) protein max isoform X1   KO K04453   Max protein Organism eai  Equus asinus (ass) Pathway eai03083   Polycomb repressive complex eai04010   MAPK signaling pathway eai05200   Pathways in cancer eai05202   Transcriptional misregulation in cancer eai05222   Small cell lung cancer Brite KEGG Orthology (KO) [BR:eai00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     106844892 (MAX)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106844892 (MAX)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     106844892 (MAX)    05202 Transcriptional misregulation in cancer     106844892 (MAX)   09162 Cancer: specific types    05222 Small cell lung cancer     106844892 (MAX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:eai03000]     106844892 (MAX)    03036 Chromosome and associated proteins [BR:eai03036]     106844892 (MAX) Transcription factors [BR:eai03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Mad/Max     106844892 (MAX) Chromosome and associated proteins [BR:eai03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.6)      106844892 (MAX) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HLH bZIP_2 JetA bHLH_INO4 bHLH_SAC51 SlyX Filament bHLH_INO2 SLX9 DUF7801 GAGA_bind Csm1_N Motif Other DBs NCBI-GeneID:  106844892 NCBI-ProteinID:  XP_044629699 LinkDB All DBs Position 7:complement(39394984..39431280) Genome browser AA seq 162 aa AA seqDB search MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKQQA SRAQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSS DNSLYTNAKGGTISAFDGGSDSSSESEPEEPQSRKKVRMEAS NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atgagcgataacgatgacatcgaggtggagagcgacgaagagcaaccgaggtttcaatct gcggctgacaaacgggctcatcataatgcactggaacgaaaacgcagggaccacatcaaa gacagctttcacagtctgcgggactcggtcccctccctccagggagagaagcaacaggca tcccgggcccaaatcctagacaaagccacagagtatatccagtatatgcgaaggaaaaac cacacacaccagcaagatattgatgacctcaagcggcagaatgctcttctggagcagcaa gtccgtgcactggagaaggcgaggtcgagtgcccaactgcagaccaactacccctcctca gacaacagcctctacaccaacgccaagggcggcaccatctctgccttcgatgggggctcg gactccagctcggagtcggagcccgaagagccccagagcaggaagaaggtccggatggag gccagctaa

DBGET integrated database retrieval system